(data stored in ACNUC7421 zone)

EMBL: CP000820.PE508

CP000820.PE508       Location/Qualifiers
FT   CDS             601149..602132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0516"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: fal:FRAAL2800
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09977"
FT                   /db_xref="GOA:A8KX74"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019923"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX74"
FT                   /protein_id="ABW09977.1"
FT                   /translation="MADARPFRFAVQTTTATSATEWRDLARRVEDLGYSTLFLADHYLG
FT                   PGPVSTQTLLRPQHLAPIAAMAAAAAWTSTLRIGCRVFCVDYHMPAALAKEAATIDLLS
FT                   DGRLEFGIGAGTNQGEYEAMGLTFHEAPQRVSKLEEVITLVKAHWSGEPISIDGDHIRV
FT                   SGYAGLPRPVQRPCPRILIGGSRKRVLSLAAREADIVSMANVPWQPRNDAGLTPAEEAQ
FT                   RRHDIVRDAAGDRFPQLELESSPYLVSVPEDVDSALAQWSARLRKAIPEAQPDLLRNHP
FT                   NVLVGSPDEITDHLQERRDRTGVNYITIPRGQIDEFAPVVSALTGR"
     MADARPFRFA VQTTTATSAT EWRDLARRVE DLGYSTLFLA DHYLGPGPVS TQTLLRPQHL        60
     APIAAMAAAA AWTSTLRIGC RVFCVDYHMP AALAKEAATI DLLSDGRLEF GIGAGTNQGE       120
     YEAMGLTFHE APQRVSKLEE VITLVKAHWS GEPISIDGDH IRVSGYAGLP RPVQRPCPRI       180
     LIGGSRKRVL SLAAREADIV SMANVPWQPR NDAGLTPAEE AQRRHDIVRD AAGDRFPQLE       240
     LESSPYLVSV PEDVDSALAQ WSARLRKAIP EAQPDLLRNH PNVLVGSPDE ITDHLQERRD       300
     RTGVNYITIP RGQIDEFAPV VSALTGR                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page