(data stored in ACNUC7421 zone)

EMBL: CP000820.PE509

CP000820.PE509       Location/Qualifiers
FT   CDS             602210..603124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0517"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: mpa:MAP2524c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09978"
FT                   /db_xref="GOA:A8KX75"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019910"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX75"
FT                   /protein_id="ABW09978.1"
FT                   /translation="MRIGLTGGASTPEKIIDQARKAEADGFHHLWYASVVQGDPLASMA
FT                   LAGRQTSTIELGTAVLQTYPCHPLLQAQRAASVTAAMGRPGFTLGLGPSHAGHIHAEYG
FT                   LSYDRPGKNTEDYLRIVTTLLRDGGADITGEEWSTHVRSGTVQPAHPVPVLLAALSPRL
FT                   LRVAGEHADGVILWMAPATAIEKHIEPKLSAAAKAAGRGALRIVAGLPVAVHDDESEAR
FT                   AAVAKNSTMYASSPAYQRIMAIGGADSPAQAAIAGDEASVERQLHALLDAGATDIWAQP
FT                   IPVGDDPRASLRRTRNLLAALAR"
     MRIGLTGGAS TPEKIIDQAR KAEADGFHHL WYASVVQGDP LASMALAGRQ TSTIELGTAV        60
     LQTYPCHPLL QAQRAASVTA AMGRPGFTLG LGPSHAGHIH AEYGLSYDRP GKNTEDYLRI       120
     VTTLLRDGGA DITGEEWSTH VRSGTVQPAH PVPVLLAALS PRLLRVAGEH ADGVILWMAP       180
     ATAIEKHIEP KLSAAAKAAG RGALRIVAGL PVAVHDDESE ARAAVAKNST MYASSPAYQR       240
     IMAIGGADSP AQAAIAGDEA SVERQLHALL DAGATDIWAQ PIPVGDDPRA SLRRTRNLLA       300
     ALAR                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page