(data stored in ACNUC7421 zone)

EMBL: CP000820.PE510

CP000820.PE510       Location/Qualifiers
FT   CDS             603227..603784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mjl:Mjls_5301 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09979"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX76"
FT                   /protein_id="ABW09979.1"
FT                   /translation="MTTPSELEELRREVRYLRDRQDILDCVNKQSRGHDRHDANLMTSV
FT                   LHEDAIDEHGPAAHIGADYGPWANKQHSEVFANHLHNITTHTCEIEGDIAHAESYVIGT
FT                   MVGRDGKTLAFMGGRYLDRLERRDGAWKIALRRCTIEWAFTANASFLHSGAFKGFLKGT
FT                   WDTTDLSYARPLQLDTGPAVRW"
     MTTPSELEEL RREVRYLRDR QDILDCVNKQ SRGHDRHDAN LMTSVLHEDA IDEHGPAAHI        60
     GADYGPWANK QHSEVFANHL HNITTHTCEI EGDIAHAESY VIGTMVGRDG KTLAFMGGRY       120
     LDRLERRDGA WKIALRRCTI EWAFTANASF LHSGAFKGFL KGTWDTTDLS YARPLQLDTG       180
     PAVRW                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page