(data stored in ACNUC7421 zone)

EMBL: CP000820.PE511

CP000820.PE511       Location/Qualifiers
FT   CDS             complement(604272..605528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL3800 hypothetical protein; putative
FT                   signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09980"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX77"
FT                   /protein_id="ABW09980.1"
FT                   /translation="MIFGRLSIRWIVSVAIVVVVAGCTLPGSGKERPVAVGCDSPGVTS
FT                   DQVKLGLVFSDSGIGSTALSSARSGVDARINLANAQGGIHGRRIFYQWRDDASSSSQNA
FT                   LATQDLVQQESVFGLVAATASLEGSLARLDAQGIPVVGIALPSWNRYRNLFSHLYMPSP
FT                   GTVARYIQAHGGTRIAVVTTGTVALTMETITQYKNAFSALGLAATDPIPYTSSSDSPQR
FT                   IVHQLAAIHADALIGFTAPEDLADIAQAARAANLRLNVDVSLTGYDKALLPAFGQALAG
FT                   VSIPVYFRPFEAGGPAIDRYRDAMTLYAPESIEPDQQFAMLAYIYTDLFLHGLDLAGTC
FT                   PTREGFIKALRGVTDYDAGGLISPVDLSANSTRPLDCFAFVRVNSTGTAFDVVHQRLCS
FT                   DGSESLPPGNESTPTGRSR"
     MIFGRLSIRW IVSVAIVVVV AGCTLPGSGK ERPVAVGCDS PGVTSDQVKL GLVFSDSGIG        60
     STALSSARSG VDARINLANA QGGIHGRRIF YQWRDDASSS SQNALATQDL VQQESVFGLV       120
     AATASLEGSL ARLDAQGIPV VGIALPSWNR YRNLFSHLYM PSPGTVARYI QAHGGTRIAV       180
     VTTGTVALTM ETITQYKNAF SALGLAATDP IPYTSSSDSP QRIVHQLAAI HADALIGFTA       240
     PEDLADIAQA ARAANLRLNV DVSLTGYDKA LLPAFGQALA GVSIPVYFRP FEAGGPAIDR       300
     YRDAMTLYAP ESIEPDQQFA MLAYIYTDLF LHGLDLAGTC PTREGFIKAL RGVTDYDAGG       360
     LISPVDLSAN STRPLDCFAF VRVNSTGTAF DVVHQRLCSD GSESLPPGNE STPTGRSR         418
//

If you have problems or comments...

PBIL Back to PBIL home page