(data stored in ACNUC7421 zone)

EMBL: CP000820.PE513

CP000820.PE513       Location/Qualifiers
FT   CDS             complement(606994..608250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0521"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG:
FT                   mba:Mbar_A3090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09982"
FT                   /db_xref="GOA:A8KX79"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX79"
FT                   /protein_id="ABW09982.1"
FT                   /translation="MHFSAKRDFLITERRVEYPVAGRRLRIATGAAASGAALATVGIFY
FT                   LRASMHPSGLGGEAETRAMVECVLLIASVALATLAGYRVAADGMRQAYAQAWKAGIREK
FT                   DSNAHFCAREFFGRAVDRLGSENNTTRLGGIYALERIAMDSPSDQRAVVEVLSAFIRTR
FT                   STDPTLRPAVSGPVVPLRPAVDIHAAVAVLGRLSVLDGVPRADLSGAKLTGPAALHCIQ
FT                   ASYGNLSNTDLTGADLSRAHLGRADLTASRLGGTDLTGASLNEANLSYTWLGGANLTRA
FT                   RLSGADLTGASLSGADLTRAWLDGADLTGASLGGANLTRAWLTEADLTRAWLGGANLIT
FT                   AVGLVQDQIDAAYGDGWTRLPPELTRPALWTSAEADEYRPADPHQVVGQWHPEVLAGQD
FT                   NALSSRDYHHTILPKVVIV"
     MHFSAKRDFL ITERRVEYPV AGRRLRIATG AAASGAALAT VGIFYLRASM HPSGLGGEAE        60
     TRAMVECVLL IASVALATLA GYRVAADGMR QAYAQAWKAG IREKDSNAHF CAREFFGRAV       120
     DRLGSENNTT RLGGIYALER IAMDSPSDQR AVVEVLSAFI RTRSTDPTLR PAVSGPVVPL       180
     RPAVDIHAAV AVLGRLSVLD GVPRADLSGA KLTGPAALHC IQASYGNLSN TDLTGADLSR       240
     AHLGRADLTA SRLGGTDLTG ASLNEANLSY TWLGGANLTR ARLSGADLTG ASLSGADLTR       300
     AWLDGADLTG ASLGGANLTR AWLTEADLTR AWLGGANLIT AVGLVQDQID AAYGDGWTRL       360
     PPELTRPALW TSAEADEYRP ADPHQVVGQW HPEVLAGQDN ALSSRDYHHT ILPKVVIV         418
//

If you have problems or comments...

PBIL Back to PBIL home page