(data stored in ACNUC7421 zone)

EMBL: CP000820.PE514

CP000820.PE514       Location/Qualifiers
FT   CDS             complement(608380..609036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09983"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX80"
FT                   /protein_id="ABW09983.1"
FT                   /translation="MTLGLTILLPESESLRLGPGGSLSKRLILRVDRNGARELRNAIFN
FT                   DNQTRLEGGLVKEWPRLPPSCLRQVWKQFAIVVGGILLALLAAANLPGPSARPAGIGAS
FT                   GVMPGASANATDRIPQLLRRYAQTAVPSLPSDAAPTRATRATVVVPNVVGLDLRTAEGL
FT                   LFPSLLPSAIDDPAWRGRRTVGPRWVVVTQKPVAGSQVPALTTIDLYAVEPRESD"
     MTLGLTILLP ESESLRLGPG GSLSKRLILR VDRNGARELR NAIFNDNQTR LEGGLVKEWP        60
     RLPPSCLRQV WKQFAIVVGG ILLALLAAAN LPGPSARPAG IGASGVMPGA SANATDRIPQ       120
     LLRRYAQTAV PSLPSDAAPT RATRATVVVP NVVGLDLRTA EGLLFPSLLP SAIDDPAWRG       180
     RRTVGPRWVV VTQKPVAGSQ VPALTTIDLY AVEPRESD                               218
//

If you have problems or comments...

PBIL Back to PBIL home page