(data stored in ACNUC7421 zone)

EMBL: CP000820.PE515

CP000820.PE515       Location/Qualifiers
FT   CDS             609387..610772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0523"
FT                   /product="WD-40 repeat protein"
FT                   /note="PFAM: WD-40 repeat protein; KEGG: fal:FRAAL3306
FT                   putative serine/threonine-protein kinase PkwA; WD40
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09984"
FT                   /db_xref="GOA:A8KX81"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX81"
FT                   /protein_id="ABW09984.1"
FT                   /translation="MQRYCTGQSVPVEFGTIERVARVCGADGDEIARLFRLWETAASIS
FT                   TSAGIELPTAGGDHEHTNPVEGVEYSTSPVSLVPPALAAADDSAPRPATQNEHSRLRGA
FT                   RRAGWRWNRRSISATAIIVVLFSSAVGTVLVLAMILAREPGVRPLGRPLADQAGWALST
FT                   AFSPDGKVMASSSRKGGVWLWNMADPATPVRIDPALTGPRDGVTSLAFSPDGSLLAGGS
FT                   WDGSIWLWDITDSGASKPAGRALTDDSGPIWSVAFSADGRTLASGSDDTTVRLWDMTNR
FT                   ARPWQFVRLSSDMEFVTSVAFSADNRLLVAAGFSRTIAIWDMADRGAPKRLAQSLSTPA
FT                   TTYVAAFSPNGRLLATGSTDGLVRLWDLAVPEDPHPIGRPLTGHTNRVWSLAFSPDGGT
FT                   LASSGFDNSVRLWDVTDLSNPEPIGAPLTGYQGWVLSVRFSPNGRVLASTSSDSTIRLW
FT                   SLP"
     MQRYCTGQSV PVEFGTIERV ARVCGADGDE IARLFRLWET AASISTSAGI ELPTAGGDHE        60
     HTNPVEGVEY STSPVSLVPP ALAAADDSAP RPATQNEHSR LRGARRAGWR WNRRSISATA       120
     IIVVLFSSAV GTVLVLAMIL AREPGVRPLG RPLADQAGWA LSTAFSPDGK VMASSSRKGG       180
     VWLWNMADPA TPVRIDPALT GPRDGVTSLA FSPDGSLLAG GSWDGSIWLW DITDSGASKP       240
     AGRALTDDSG PIWSVAFSAD GRTLASGSDD TTVRLWDMTN RARPWQFVRL SSDMEFVTSV       300
     AFSADNRLLV AAGFSRTIAI WDMADRGAPK RLAQSLSTPA TTYVAAFSPN GRLLATGSTD       360
     GLVRLWDLAV PEDPHPIGRP LTGHTNRVWS LAFSPDGGTL ASSGFDNSVR LWDVTDLSNP       420
     EPIGAPLTGY QGWVLSVRFS PNGRVLASTS SDSTIRLWSL P                           461
//

If you have problems or comments...

PBIL Back to PBIL home page