(data stored in ACNUC7421 zone)

EMBL: CP000820.PE518

CP000820.PE518       Location/Qualifiers
FT   CDS             614022..614954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0527"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   KEGG: sma:SAV4144 two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09987"
FT                   /db_xref="GOA:A8KX84"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX84"
FT                   /protein_id="ABW09987.1"
FT                   /translation="MNRSGAPWPCHCGPHDPVVAVAPLLRTPALLGCVALGAAGAGGLV
FT                   AAVAAGTTGPGNAPGTAAVEAAMFYAYTVVLVALTYRVSTWMLGVVWEIDRSRAAHASL
FT                   AVAEERLRFARDLHDVLGYNLSLMAVQSELAARLADLGAELAGAQSLLRSAGVACQVTG
FT                   AASRDGREQALPPSAQAALGWVVREATTNVIHHSEATTCAIDLEVRDGPGHARTAVLRI
FT                   TNDGVPPVPAGATRPGGSPPAPGAGSGLAGIEERLAGLGGVLTAAREPGGSFVLEARLP
FT                   VPADAAHGAAPVGTPPPARGAAIVLEAGS"
     MNRSGAPWPC HCGPHDPVVA VAPLLRTPAL LGCVALGAAG AGGLVAAVAA GTTGPGNAPG        60
     TAAVEAAMFY AYTVVLVALT YRVSTWMLGV VWEIDRSRAA HASLAVAEER LRFARDLHDV       120
     LGYNLSLMAV QSELAARLAD LGAELAGAQS LLRSAGVACQ VTGAASRDGR EQALPPSAQA       180
     ALGWVVREAT TNVIHHSEAT TCAIDLEVRD GPGHARTAVL RITNDGVPPV PAGATRPGGS       240
     PPAPGAGSGL AGIEERLAGL GGVLTAAREP GGSFVLEARL PVPADAAHGA APVGTPPPAR       300
     GAAIVLEAGS                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page