(data stored in ACNUC7421 zone)

EMBL: CP000820.PE520

CP000820.PE520       Location/Qualifiers
FT   CDS             complement(615599..618124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0529"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   sma:SAV3635 putative ABC transporter integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09989"
FT                   /db_xref="GOA:A8KX86"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX86"
FT                   /protein_id="ABW09989.1"
FT                   /translation="MIRLVWHTVRARKGSLVGTFVALTLGVALLAAMALTLVSSVGGGG
FT                   GRPTWYVDADVVVAGGGIVSVTTGSGEDRETASLRTATARGLPSGLRDRLAGLDASLVL
FT                   DFAAYATAPGAPGDTVRPWSAAALHAYGWVAGGPPRGARDVVLSAPTAHRPGAEITVVT
FT                   GRGVERFVVSGVLRTDAPAALYTADAVAEELADGRVAAVALNAPGAGPAGASTPAVMSL
FT                   ADAARAVVGDTALEDGSVQVLTGDDRRRAEPDPDAERRTEAVALLAATTGLAGFVSIFV
FT                   VSGTFAYAVTARRREFGLLRAAGATPRQVFRIVLGEALTVGVLASLAGGALGAAIAPDF
FT                   AARLARTGFVPSDFTARFVFWPVAAAFGTGLGVALLGAWVAARRAGRVRPVEALRDAAV
FT                   DRRPMTTARALAGLLALGCCVPLVAVLVANPSADAVALIMITALFLIVACAMFAPLVVP
FT                   PLVSLLSAPLSGSSGAVGLLAGHGARAAVLRTAATAAPILVTVGIAGSTLTGLGTLQAA
FT                   TQNAARERITAEALTMPVTGKGLPDASVAALREVPGVSAAVPVTESRVYVRDGDEPEGW
FT                   TGYYASGADLAAVLDVPLVAGSLADLAGTDTVAVPEGRWELGETAELWLGDSTPARLRV
FT                   VAVFERQLDLSETVLLPSRLRDRHALPGADVVYLRLAPDASLEQVRAAAAAGAGTVVDT
FT                   GSYLSAAGEEEARVNRQASVAMLGLSLVYTGIAIANTLVMATRDRAREFATIRLAGATR
FT                   RQVLWVVGTEAVLVTCIGVLLAAVVTAVTALGARHGLADIAPSVPLAVPWAPLAGIVLA
FT                   CLVTAVLASVIPAALLLRRRPAELAGVRE"
     MIRLVWHTVR ARKGSLVGTF VALTLGVALL AAMALTLVSS VGGGGGRPTW YVDADVVVAG        60
     GGIVSVTTGS GEDRETASLR TATARGLPSG LRDRLAGLDA SLVLDFAAYA TAPGAPGDTV       120
     RPWSAAALHA YGWVAGGPPR GARDVVLSAP TAHRPGAEIT VVTGRGVERF VVSGVLRTDA       180
     PAALYTADAV AEELADGRVA AVALNAPGAG PAGASTPAVM SLADAARAVV GDTALEDGSV       240
     QVLTGDDRRR AEPDPDAERR TEAVALLAAT TGLAGFVSIF VVSGTFAYAV TARRREFGLL       300
     RAAGATPRQV FRIVLGEALT VGVLASLAGG ALGAAIAPDF AARLARTGFV PSDFTARFVF       360
     WPVAAAFGTG LGVALLGAWV AARRAGRVRP VEALRDAAVD RRPMTTARAL AGLLALGCCV       420
     PLVAVLVANP SADAVALIMI TALFLIVACA MFAPLVVPPL VSLLSAPLSG SSGAVGLLAG       480
     HGARAAVLRT AATAAPILVT VGIAGSTLTG LGTLQAATQN AARERITAEA LTMPVTGKGL       540
     PDASVAALRE VPGVSAAVPV TESRVYVRDG DEPEGWTGYY ASGADLAAVL DVPLVAGSLA       600
     DLAGTDTVAV PEGRWELGET AELWLGDSTP ARLRVVAVFE RQLDLSETVL LPSRLRDRHA       660
     LPGADVVYLR LAPDASLEQV RAAAAAGAGT VVDTGSYLSA AGEEEARVNR QASVAMLGLS       720
     LVYTGIAIAN TLVMATRDRA REFATIRLAG ATRRQVLWVV GTEAVLVTCI GVLLAAVVTA       780
     VTALGARHGL ADIAPSVPLA VPWAPLAGIV LACLVTAVLA SVIPAALLLR RRPAELAGVR       840
     E                                                                       841
//

If you have problems or comments...

PBIL Back to PBIL home page