(data stored in ACNUC7421 zone)

EMBL: CP000820.PE521

CP000820.PE521       Location/Qualifiers
FT   CDS             complement(618121..618954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0530"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sma:SAV3634 putative ABC-transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09990"
FT                   /db_xref="GOA:A8KX87"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX87"
FT                   /protein_id="ABW09990.1"
FT                   /translation="MTAAVALRGVSKVYGRRTAAVTALDDVTLAFVCGTFTAVMGPSGS
FT                   GKSTLLQCAAGLDRPTAGEVFLDGENLARLSENALTVLRRDRVGFVFQAFNLVPSLTAE
FT                   LNVALPLRLAGRRPRRREVREVLEAVGLADRGRRRPAELSGGQQQRVAIARALVTRPSV
FT                   LFADEPTGALDSTTGREVLTLLRGLVDRDGQTIVMVTHDPVAASHADRVVFLADGRPAG
FT                   ELRDPTPRTVAARLAGLEPVAEAAEAAEATAAAVTRARAGEPPSGRLTGPVGERP"
     MTAAVALRGV SKVYGRRTAA VTALDDVTLA FVCGTFTAVM GPSGSGKSTL LQCAAGLDRP        60
     TAGEVFLDGE NLARLSENAL TVLRRDRVGF VFQAFNLVPS LTAELNVALP LRLAGRRPRR       120
     REVREVLEAV GLADRGRRRP AELSGGQQQR VAIARALVTR PSVLFADEPT GALDSTTGRE       180
     VLTLLRGLVD RDGQTIVMVT HDPVAASHAD RVVFLADGRP AGELRDPTPR TVAARLAGLE       240
     PVAEAAEAAE ATAAAVTRAR AGEPPSGRLT GPVGERP                                277
//

If you have problems or comments...

PBIL Back to PBIL home page