(data stored in ACNUC7421 zone)

EMBL: CP000820.PE527

CP000820.PE527       Location/Qualifiers
FT   CDS             624519..624797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09996"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX93"
FT                   /protein_id="ABW09996.1"
FT                   /translation="MDRWHKAGGAPAGRPVALHDYLGLGPIEYALWVERPSSLRFVTEA
FT                   RRAGRRVDDITGLASIAVEEANDDDAEAQRLVAWLRATRRIPTDHTG"
     MDRWHKAGGA PAGRPVALHD YLGLGPIEYA LWVERPSSLR FVTEARRAGR RVDDITGLAS        60
     IAVEEANDDD AEAQRLVAWL RATRRIPTDH TG                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page