(data stored in ACNUC7421 zone)

EMBL: CP000820.PE528

CP000820.PE528       Location/Qualifiers
FT   CDS             complement(625110..625553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0538"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL0474 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09997"
FT                   /db_xref="GOA:A8KX94"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX94"
FT                   /protein_id="ABW09997.1"
FT                   /translation="MGVPADPGELLKLGHRVVDFFHVDCAVTLRRLYCFFVLDVGTRTV
FT                   HILGVTTHPDGPWTTQQARNLLMDLGARAADFQVLVRDRAGQFTASFDAVLAGAGITAV
FT                   KIPPRTPRTNAYAERFVRTVRTEVTGPACDGWVAMPPRSLPRT"
     MGVPADPGEL LKLGHRVVDF FHVDCAVTLR RLYCFFVLDV GTRTVHILGV TTHPDGPWTT        60
     QQARNLLMDL GARAADFQVL VRDRAGQFTA SFDAVLAGAG ITAVKIPPRT PRTNAYAERF       120
     VRTVRTEVTG PACDGWVAMP PRSLPRT                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page