(data stored in ACNUC7421 zone)

EMBL: CP000820.PE529

CP000820.PE529       Location/Qualifiers
FT   CDS             625581..625838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09998"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX95"
FT                   /protein_id="ABW09998.1"
FT                   /translation="MRVAISVLTGGRPVLWGWVHFRVIRRRCHRRTVPGVTGRCARSVL
FT                   GRTLISAASTARSAQSQRGLGWVRRSTATSCRRQTSGSDR"
     MRVAISVLTG GRPVLWGWVH FRVIRRRCHR RTVPGVTGRC ARSVLGRTLI SAASTARSAQ        60
     SQRGLGWVRR STATSCRRQT SGSDR                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page