(data stored in ACNUC7421 zone)

EMBL: CP000820.PE53

CP000820.PE53        Location/Qualifiers
FT   CDS             complement(67290..68258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0054"
FT                   /product="putative O-methyltransferase"
FT                   /note="KEGG: fal:FRAAL6342 putative protein; putative
FT                   signal peptide; putative O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09522"
FT                   /db_xref="GOA:A8LB61"
FT                   /db_xref="InterPro:IPR023809"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB61"
FT                   /protein_id="ABW09522.1"
FT                   /translation="MPAHSLSVTAPRDLAAGVLAVLAGADLRATATSNALDPADLDDAV
FT                   RVYQAAGLAALEQRADQDCYQVRVQFPDWSTAEATAVTQLGPRLDQLQDSGVVGGWWFL
FT                   RKHPCWRLRLHHTDTAAVDQVLDELTAAGALARWWSTVYEPETFAFGGPAGMDTVHELF
FT                   CADSRGVLDYLRHDTPGLGRRELSILLINGLLQTAGLDTFERGDVFARVAGLRPASAAA
FT                   DHPKIAQLAANVRLLLSIPDLPTSDLFAPGGPVAHAAPWLSAFHTAGRQLGDTAAQAQL
FT                   GRGLRAIVTHVLIFHWNRLGLSATSQAVLARAAATALLPRD"
     MPAHSLSVTA PRDLAAGVLA VLAGADLRAT ATSNALDPAD LDDAVRVYQA AGLAALEQRA        60
     DQDCYQVRVQ FPDWSTAEAT AVTQLGPRLD QLQDSGVVGG WWFLRKHPCW RLRLHHTDTA       120
     AVDQVLDELT AAGALARWWS TVYEPETFAF GGPAGMDTVH ELFCADSRGV LDYLRHDTPG       180
     LGRRELSILL INGLLQTAGL DTFERGDVFA RVAGLRPASA AADHPKIAQL AANVRLLLSI       240
     PDLPTSDLFA PGGPVAHAAP WLSAFHTAGR QLGDTAAQAQ LGRGLRAIVT HVLIFHWNRL       300
     GLSATSQAVL ARAAATALLP RD                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page