(data stored in ACNUC7421 zone)

EMBL: CP000820.PE54

CP000820.PE54        Location/Qualifiers
FT   CDS             complement(68240..69427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0055"
FT                   /product="Lanthionine synthetase C family protein"
FT                   /note="PFAM: Lanthionine synthetase C family protein; KEGG:
FT                   fal:FRAAL6343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09523"
FT                   /db_xref="InterPro:IPR007822"
FT                   /db_xref="InterPro:IPR033889"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB62"
FT                   /protein_id="ABW09523.1"
FT                   /translation="MTPGTAAAVETFSADDAVRQSLARGPVGTALLQIERARTGSGGWD
FT                   TAHAHIRRAVAGPVDAAEHAGLYYGAPALAFLLQAAADGNPRYRRARDTLDTHVLRLTR
FT                   RRLTLAASRATRGEPTAFAEYDLFYGLTGIGTLLLRSHPDSEILADVLRYTVSLTRPRR
FT                   ENGVNLPGWWVTHDPDDTLPTPGGHANLGMAHGAAGLLALLALATAEGHLVDGQGEAIA
FT                   TLTSWFDQWRQDGADAPWWPQWITREDLRTGRPTQTSPGRVSWCYGTIGIARAQQLAAL
FT                   ATHDQQRAQDAESTLAAALTDTQLDRISDLGLCHGLAGIYQTAYRAARDARSSAIGRRL
FT                   PAIAARLAQHATASSVTGEQDSGLLTGTAGIALALESTRHVGPPRTGWDTCLLIA"
     MTPGTAAAVE TFSADDAVRQ SLARGPVGTA LLQIERARTG SGGWDTAHAH IRRAVAGPVD        60
     AAEHAGLYYG APALAFLLQA AADGNPRYRR ARDTLDTHVL RLTRRRLTLA ASRATRGEPT       120
     AFAEYDLFYG LTGIGTLLLR SHPDSEILAD VLRYTVSLTR PRRENGVNLP GWWVTHDPDD       180
     TLPTPGGHAN LGMAHGAAGL LALLALATAE GHLVDGQGEA IATLTSWFDQ WRQDGADAPW       240
     WPQWITREDL RTGRPTQTSP GRVSWCYGTI GIARAQQLAA LATHDQQRAQ DAESTLAAAL       300
     TDTQLDRISD LGLCHGLAGI YQTAYRAARD ARSSAIGRRL PAIAARLAQH ATASSVTGEQ       360
     DSGLLTGTAG IALALESTRH VGPPRTGWDT CLLIA                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page