(data stored in ACNUC7421 zone)

EMBL: CP000820.PE540

CP000820.PE540       Location/Qualifiers
FT   CDS             637442..638293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0550"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: fal:FRAAL3443
FT                   putative TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10009"
FT                   /db_xref="GOA:A8KXA6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXA6"
FT                   /protein_id="ABW10009.1"
FT                   /translation="MRRPYLVYRPISVQCLVSMQSTIQARRTMSSVGEQTPGRRARLRA
FT                   QTTAEIQAIALRHMAEGGPDAISLRAIAREMDMSGSAIYSYFATRDALIARLINDVYTS
FT                   LMDEVEIARDALPPDDIAGRILALGQAVRRWSVANPERFRLIYDHPAPGHHAPGDGSTF
FT                   DAAKRACLALTELVAAAWPHAEPVQPVGDHQWSDFAPDLVTAVRDAFPELPPAGVALAM
FT                   RVWGRMHGLVALEVHGHLGLLTNDPAELYRVELLDLIRSLGLGQDIDRPGISKPASRTP
FT                   PH"
     MRRPYLVYRP ISVQCLVSMQ STIQARRTMS SVGEQTPGRR ARLRAQTTAE IQAIALRHMA        60
     EGGPDAISLR AIAREMDMSG SAIYSYFATR DALIARLIND VYTSLMDEVE IARDALPPDD       120
     IAGRILALGQ AVRRWSVANP ERFRLIYDHP APGHHAPGDG STFDAAKRAC LALTELVAAA       180
     WPHAEPVQPV GDHQWSDFAP DLVTAVRDAF PELPPAGVAL AMRVWGRMHG LVALEVHGHL       240
     GLLTNDPAEL YRVELLDLIR SLGLGQDIDR PGISKPASRT PPH                         283
//

If you have problems or comments...

PBIL Back to PBIL home page