(data stored in ACNUC7421 zone)

EMBL: CP000820.PE546

CP000820.PE546       Location/Qualifiers
FT   CDS             641796..642038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10015"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXB2"
FT                   /protein_id="ABW10015.1"
FT                   /translation="MSCSVESGDGTAGPPPSAFPAPPAHRSLSRLLCWRKFGRPGSGHD
FT                   PFRWAAQPPAHLCSKAGDWITGQTMVVDGGWIKRL"
     MSCSVESGDG TAGPPPSAFP APPAHRSLSR LLCWRKFGRP GSGHDPFRWA AQPPAHLCSK        60
     AGDWITGQTM VVDGGWIKRL                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page