(data stored in ACNUC7421 zone)

EMBL: CP000820.PE55

CP000820.PE55        Location/Qualifiers
FT   CDS             complement(69424..72531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0056"
FT                   /product="Lantibiotic dehydratase domain protein"
FT                   /note="PFAM: Lantibiotic dehydratase domain protein; KEGG:
FT                   fal:FRAAL6344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09524"
FT                   /db_xref="InterPro:IPR006827"
FT                   /db_xref="InterPro:IPR023809"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB63"
FT                   /protein_id="ABW09524.1"
FT                   /translation="MPMPPRYQHTGFIQVRASTDPGGLDLPTDLDLSDSAAVEQEGRAW
FT                   LAKTWARPEVREALRLASADLCARIEQILDDGAGRRSGAEIQRALTAVASYLLRWQRRA
FT                   TPFGMFAGISTATAGPATAEVGRAHQAVARADAEWVTALADQLERHPELRGRLTVVTDS
FT                   ARIVRDGRVIVHRRAEVGAPSPGPLRESSVRLTRPVFFALAEAGNPIRLDALVARTATR
FT                   FPTASPDKIRALVHGLVDGGLLITSLRPPTTGVDALTHLADALRAAGLEGLADVSDLLR
FT                   EIDCLRAMLAAHNRITDPQPAAQTRRTVAARMASLAPGAGQMLAVDTRLDANIAVPGRV
FT                   LTEAALAASVLLRLSRQPFGSTAWLDYHARFRARYGPGALVPVRELVAESGLGYPGGYL
FT                   GAPRARPAWRMLTDRDTALLALIQRAAVDGAEEIALTDADVEELAVGERGDVVPPQRVE
FT                   LGVEVWAVSTRAIDRGDFRLRVTAAPRTGTSMAGRFAYLLGPADRDRLAATYAASAEAG
FT                   ERDQPLAAQLSFPPRRPHNENVVRVEPLLPAVISLSEHPDPAHAKVRLIDLDDLVVTAD
FT                   AAQMYLVQRSTGRRVIPRIPHALDTSVQSPPLARFLAEVADARTAVFGGLDLGAARVLS
FT                   YIPRIRYGRTVLAVARWTLTSTDLPRGQSGDGRQEALCAWRQRWRVPARVVLCHSELRL
FT                   PLDLDRHLDRVLFLTRLERAGRIEVQEDGPPDAQGWIGRPAELLIPLTAISPPARPLPV
FT                   TAAPGAVLRPGDAAVLHAQLVGNPARFDDILTGHLPRLADSLEGLVCLWWVRRHRDMIL
FT                   PESDQHLAVFLRLRSTDHYGPVAAAVASFAADLETRGLPGQLTLASSPQHPARYGDGDA
FT                   LAAAESVFAADTLCATAQITAAQTSGISAQALAAASMVDLAAAFAPDPLAGYQALVGCL
FT                   RQEHGALDRTLRDQALDLADPGGNHQAVRALTGGEAVVSVWNARAIVLASYYQALARQR
FT                   DPRTVLRTLLHEHHVRAVGVDPTLEKETGRLARASALRHLALAGAR"
     MPMPPRYQHT GFIQVRASTD PGGLDLPTDL DLSDSAAVEQ EGRAWLAKTW ARPEVREALR        60
     LASADLCARI EQILDDGAGR RSGAEIQRAL TAVASYLLRW QRRATPFGMF AGISTATAGP       120
     ATAEVGRAHQ AVARADAEWV TALADQLERH PELRGRLTVV TDSARIVRDG RVIVHRRAEV       180
     GAPSPGPLRE SSVRLTRPVF FALAEAGNPI RLDALVARTA TRFPTASPDK IRALVHGLVD       240
     GGLLITSLRP PTTGVDALTH LADALRAAGL EGLADVSDLL REIDCLRAML AAHNRITDPQ       300
     PAAQTRRTVA ARMASLAPGA GQMLAVDTRL DANIAVPGRV LTEAALAASV LLRLSRQPFG       360
     STAWLDYHAR FRARYGPGAL VPVRELVAES GLGYPGGYLG APRARPAWRM LTDRDTALLA       420
     LIQRAAVDGA EEIALTDADV EELAVGERGD VVPPQRVELG VEVWAVSTRA IDRGDFRLRV       480
     TAAPRTGTSM AGRFAYLLGP ADRDRLAATY AASAEAGERD QPLAAQLSFP PRRPHNENVV       540
     RVEPLLPAVI SLSEHPDPAH AKVRLIDLDD LVVTADAAQM YLVQRSTGRR VIPRIPHALD       600
     TSVQSPPLAR FLAEVADART AVFGGLDLGA ARVLSYIPRI RYGRTVLAVA RWTLTSTDLP       660
     RGQSGDGRQE ALCAWRQRWR VPARVVLCHS ELRLPLDLDR HLDRVLFLTR LERAGRIEVQ       720
     EDGPPDAQGW IGRPAELLIP LTAISPPARP LPVTAAPGAV LRPGDAAVLH AQLVGNPARF       780
     DDILTGHLPR LADSLEGLVC LWWVRRHRDM ILPESDQHLA VFLRLRSTDH YGPVAAAVAS       840
     FAADLETRGL PGQLTLASSP QHPARYGDGD ALAAAESVFA ADTLCATAQI TAAQTSGISA       900
     QALAAASMVD LAAAFAPDPL AGYQALVGCL RQEHGALDRT LRDQALDLAD PGGNHQAVRA       960
     LTGGEAVVSV WNARAIVLAS YYQALARQRD PRTVLRTLLH EHHVRAVGVD PTLEKETGRL      1020
     ARASALRHLA LAGAR                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page