(data stored in ACNUC7421 zone)

EMBL: CP000820.PE552

CP000820.PE552       Location/Qualifiers
FT   CDS             647077..647499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0562"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ace:Acel_0724 major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10021"
FT                   /db_xref="GOA:A8KXB8"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXB8"
FT                   /protein_id="ABW10021.1"
FT                   /translation="MLAALIGVTTSAVQAGAMRGVVWAAQGLRVSARNALLADIVPAAY
FT                   GFEWTMDNLGAIVGPLLALGLLSLVSVRTAMLLSVVPGLLASVQAVGNIAASVVAGLLY
FT                   TVASPTLAFSYLAVWMVLALTALLWATRNTAVHGDQ"
     MLAALIGVTT SAVQAGAMRG VVWAAQGLRV SARNALLADI VPAAYGFEWT MDNLGAIVGP        60
     LLALGLLSLV SVRTAMLLSV VPGLLASVQA VGNIAASVVA GLLYTVASPT LAFSYLAVWM       120
     VLALTALLWA TRNTAVHGDQ                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page