(data stored in ACNUC7421 zone)

EMBL: CP000820.PE554

CP000820.PE554       Location/Qualifiers
FT   CDS             648063..648569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0564"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: fal:FRAAL3367 cadmium-induced
FT                   protein CadI (partial match)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10023"
FT                   /db_xref="GOA:A8KXC0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXC0"
FT                   /protein_id="ABW10023.1"
FT                   /translation="MARVQLALNVSDVDAAVEFYTKLFGVEPAKRRPGYANFAVEVPPL
FT                   KLVLIENPDARGTGVAGALNHLGVEIETSEEVSAAATRLQDSGLVTAVEENTACCYALQ
FT                   DKVWVDDPDGAPWEIYTVLADIAESTGTQLRTVEPGDGPGSACDCGPVCAPRVTIEPAP
FT                   AGVTR"
     MARVQLALNV SDVDAAVEFY TKLFGVEPAK RRPGYANFAV EVPPLKLVLI ENPDARGTGV        60
     AGALNHLGVE IETSEEVSAA ATRLQDSGLV TAVEENTACC YALQDKVWVD DPDGAPWEIY       120
     TVLADIAEST GTQLRTVEPG DGPGSACDCG PVCAPRVTIE PAPAGVTR                    168
//

If you have problems or comments...

PBIL Back to PBIL home page