(data stored in ACNUC7421 zone)

EMBL: CP000820.PE559

CP000820.PE559       Location/Qualifiers
FT   CDS             655376..655804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0569"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   fal:FRAAL2957 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10028"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXC5"
FT                   /protein_id="ABW10028.1"
FT                   /translation="MTDADADAGAGASSARRWFTPVTEQLTPADLKIDVSHSARVYDYF
FT                   LGGKDNFPADREAAEQTLAIFPDMRTGARENRAFLHRATRKLVRELGLRQFLDIGTGIP
FT                   TSPNLHEVAQEAAADARIVYADNDPIVLAQFQAPHQHL"
     MTDADADAGA GASSARRWFT PVTEQLTPAD LKIDVSHSAR VYDYFLGGKD NFPADREAAE        60
     QTLAIFPDMR TGARENRAFL HRATRKLVRE LGLRQFLDIG TGIPTSPNLH EVAQEAAADA       120
     RIVYADNDPI VLAQFQAPHQ HL                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page