(data stored in ACNUC7421 zone)

EMBL: CP000820.PE562

CP000820.PE562       Location/Qualifiers
FT   CDS             complement(658712..659566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0572"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbt:BBta_6987 putative exported protein of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10031"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXC8"
FT                   /protein_id="ABW10031.1"
FT                   /translation="MPRLFGWLAALAAAIVVTAILGPAPPASAGEYGPDTCRQGWVWRE
FT                   AVPGDHVCVTPQTRNQTWADNAQAANRREPAGGPYGPDTCRQGWVWREAVPGDHVCVTP
FT                   QTRSQAWADNAQAASRVAPDIPPPCRAVGGLPSDRGIPKQVVRCSVSGYWRATFTAFVH
FT                   DYTIFGSDAGSSVRVEHFENGSWVERPARMISVHNEYSARRAGEAGNTDCPVFGSMTGR
FT                   CWVPPAPRDCRIENASSIDCRDYAIGTPFSGINLNARSVRSTGSLTFGNGQFTTLPLVA
FT                   DSF"
     MPRLFGWLAA LAAAIVVTAI LGPAPPASAG EYGPDTCRQG WVWREAVPGD HVCVTPQTRN        60
     QTWADNAQAA NRREPAGGPY GPDTCRQGWV WREAVPGDHV CVTPQTRSQA WADNAQAASR       120
     VAPDIPPPCR AVGGLPSDRG IPKQVVRCSV SGYWRATFTA FVHDYTIFGS DAGSSVRVEH       180
     FENGSWVERP ARMISVHNEY SARRAGEAGN TDCPVFGSMT GRCWVPPAPR DCRIENASSI       240
     DCRDYAIGTP FSGINLNARS VRSTGSLTFG NGQFTTLPLV ADSF                        284
//

If you have problems or comments...

PBIL Back to PBIL home page