(data stored in ACNUC7421 zone)

EMBL: CP000820.PE563

CP000820.PE563       Location/Qualifiers
FT   CDS             complement(660451..665550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0573"
FT                   /product="transcriptional activator domain"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   transcriptional activator domain; SMART: WD-40 repeat
FT                   protein; KEGG: sen:SACE_2545 WD-40 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10032"
FT                   /db_xref="GOA:A8KXC9"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXC9"
FT                   /protein_id="ABW10032.1"
FT                   /translation="MLDEGIGAAGDEPSVQNRTPPAGGRPAGLSFQVLGPLEVRRGGTP
FT                   VQLRGTRERTLLAILLSERNRAVPLSRLVTGLWGAQPPASAERTVQAYVARLRPMLEPE
FT                   RPEAGWSVLVTSPTGYCLRVDDAAFDAASFARLVDRAQSALVAGAPDLALTRFRRAEAM
FT                   WRGDEPYQDLADVAYLTPERDRLIELRLTAAADRLDAERALGRAAGTVGDLRRLVADHP
FT                   TNERFWGQLMVALYESQRQKEALDTYRAAWTRLVDDGGIEPGPKLRALHDTIVSQRPVE
FT                   VAWPVRPGDVPAPLSADRTPLIGRDGAQRWLRDVWDQVLDDVGRLVVVEAEPGGGASRL
FT                   LAEFARTVAARGAVVETTLTPALTTQVAQRPVLVVVDQPAGPEPAEAVPAGLGPAGAES
FT                   AGVGPAGRGPAWVKRVAAAVGGSGRPVLVVVVVAASDRAAHPDEWADAVPAERVLRLGP
FT                   LGGDAVGNIVAGYVQPADLDEATSVILDTAGGNPARVHEAAARWAAERARAQAGRSAER
FT                   MAAVHRTLAQAEQEMLDDVTDLQRVRASRAPGPDTVVCPYKGLARFDEADAAYFFGRQR
FT                   LIAQLVTGCVAAPLLTVVGPSGSGKSSVVRAGLLPALRAGALPGSERWRYTPLRTGATD
FT                   EAALRAVLRDGGAEDPDGTDLLVLDQFEEAFTAWSPATRTAVVDWLVGELELRDGRLRV
FT                   VITVRADYYGRFAHHPTLARLIGRNTLLVGPMTDDELSQAIEQPARVAGLGVEDGFVAA
FT                   VLGDAKHEPGALPLLSTALLATWERRDGRMLRTAAYREAGGVAGAVTRLAEDVYKGLDP
FT                   GEQAIARRLLLRLVSPGEDGLDVRRRAARDELVDSDAADRILTLLVERRLVTADDDTVE
FT                   VAHEALLRAWPRLRGWLEADRDGRRLHRQLTEAAAAWQRSDQDPGYLYHGTRLHALQEW
FT                   AQANPGDANALERLFLAASVAVEERQLRDARRSARRSRSWASVLAILLVVALTMTVLAV
FT                   VQWSAANQQANVAREATTLSQAGRLATLAANLGPDQVDLALLLGVQGYQLAPSRDTEGG
FT                   LQAALARTPANLDQIIRFPSSSFLPAVVPPSVSPDGRLVAAPGQDGTVRLWDLHAARIV
FT                   RELHWPTGRQLAVFSADASMLAVGGSDGKVVVWEVATGRQVGAPIPAGTGLAYGQFDPR
FT                   DPDRFFAVDNSGQIVAWDRSVPERPRQLGQPLRFPAAPGEIPIFVLNATGTRMAAGAYG
FT                   RPTTRVWDIDSGAVLRDLAGAPGFFGADGVTLPTSLRDRVTLWDVNTGLAKQELTGLSG
FT                   AAPGIVLSQNLRRLAVNDGGNAIRIFDVGSGREQVTLSAAGRASTPVAFLADGRLMTSG
FT                   AAEADIWRLDRGGSPLGFTLAGHDGRVTGSFTASGTEVITQGLDDHRVLVWDAADGREL
FT                   GPLLNGAVSAPVALSPDGARIVGVGANGVLRLWDRAGKTELAVLAPADHPAAVEWSPAG
FT                   DRVAAVHAGGVLLWDVGDPHRPRLVADLDTAGSTGSTGQPRPAFSPDGQRLAVTDQQGH
FT                   RITMFDAATGRSVWLRQLETADQATLAFSPDSTKIAIGFGTIASGFVEFLDTSDGTVRR
FT                   HLNTTSVGGVAFLRDGDLVMTTSDTGDQSSVQLWDATTTASVGEPATQAHGAGILARSP
FT                   DGMSVVAGSDRGIAQVWHVDLPEWMATACRIAGRNLTRVEWERYLPGEPYRASCAQWPP
FT                   TP"
     MLDEGIGAAG DEPSVQNRTP PAGGRPAGLS FQVLGPLEVR RGGTPVQLRG TRERTLLAIL        60
     LSERNRAVPL SRLVTGLWGA QPPASAERTV QAYVARLRPM LEPERPEAGW SVLVTSPTGY       120
     CLRVDDAAFD AASFARLVDR AQSALVAGAP DLALTRFRRA EAMWRGDEPY QDLADVAYLT       180
     PERDRLIELR LTAAADRLDA ERALGRAAGT VGDLRRLVAD HPTNERFWGQ LMVALYESQR       240
     QKEALDTYRA AWTRLVDDGG IEPGPKLRAL HDTIVSQRPV EVAWPVRPGD VPAPLSADRT       300
     PLIGRDGAQR WLRDVWDQVL DDVGRLVVVE AEPGGGASRL LAEFARTVAA RGAVVETTLT       360
     PALTTQVAQR PVLVVVDQPA GPEPAEAVPA GLGPAGAESA GVGPAGRGPA WVKRVAAAVG       420
     GSGRPVLVVV VVAASDRAAH PDEWADAVPA ERVLRLGPLG GDAVGNIVAG YVQPADLDEA       480
     TSVILDTAGG NPARVHEAAA RWAAERARAQ AGRSAERMAA VHRTLAQAEQ EMLDDVTDLQ       540
     RVRASRAPGP DTVVCPYKGL ARFDEADAAY FFGRQRLIAQ LVTGCVAAPL LTVVGPSGSG       600
     KSSVVRAGLL PALRAGALPG SERWRYTPLR TGATDEAALR AVLRDGGAED PDGTDLLVLD       660
     QFEEAFTAWS PATRTAVVDW LVGELELRDG RLRVVITVRA DYYGRFAHHP TLARLIGRNT       720
     LLVGPMTDDE LSQAIEQPAR VAGLGVEDGF VAAVLGDAKH EPGALPLLST ALLATWERRD       780
     GRMLRTAAYR EAGGVAGAVT RLAEDVYKGL DPGEQAIARR LLLRLVSPGE DGLDVRRRAA       840
     RDELVDSDAA DRILTLLVER RLVTADDDTV EVAHEALLRA WPRLRGWLEA DRDGRRLHRQ       900
     LTEAAAAWQR SDQDPGYLYH GTRLHALQEW AQANPGDANA LERLFLAASV AVEERQLRDA       960
     RRSARRSRSW ASVLAILLVV ALTMTVLAVV QWSAANQQAN VAREATTLSQ AGRLATLAAN      1020
     LGPDQVDLAL LLGVQGYQLA PSRDTEGGLQ AALARTPANL DQIIRFPSSS FLPAVVPPSV      1080
     SPDGRLVAAP GQDGTVRLWD LHAARIVREL HWPTGRQLAV FSADASMLAV GGSDGKVVVW      1140
     EVATGRQVGA PIPAGTGLAY GQFDPRDPDR FFAVDNSGQI VAWDRSVPER PRQLGQPLRF      1200
     PAAPGEIPIF VLNATGTRMA AGAYGRPTTR VWDIDSGAVL RDLAGAPGFF GADGVTLPTS      1260
     LRDRVTLWDV NTGLAKQELT GLSGAAPGIV LSQNLRRLAV NDGGNAIRIF DVGSGREQVT      1320
     LSAAGRASTP VAFLADGRLM TSGAAEADIW RLDRGGSPLG FTLAGHDGRV TGSFTASGTE      1380
     VITQGLDDHR VLVWDAADGR ELGPLLNGAV SAPVALSPDG ARIVGVGANG VLRLWDRAGK      1440
     TELAVLAPAD HPAAVEWSPA GDRVAAVHAG GVLLWDVGDP HRPRLVADLD TAGSTGSTGQ      1500
     PRPAFSPDGQ RLAVTDQQGH RITMFDAATG RSVWLRQLET ADQATLAFSP DSTKIAIGFG      1560
     TIASGFVEFL DTSDGTVRRH LNTTSVGGVA FLRDGDLVMT TSDTGDQSSV QLWDATTTAS      1620
     VGEPATQAHG AGILARSPDG MSVVAGSDRG IAQVWHVDLP EWMATACRIA GRNLTRVEWE      1680
     RYLPGEPYRA SCAQWPPTP                                                   1699
//

If you have problems or comments...

PBIL Back to PBIL home page