(data stored in ACNUC7421 zone)

EMBL: CP000820.PE564

CP000820.PE564       Location/Qualifiers
FT   CDS             665803..666447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0574"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   fal:FRAAL0617 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10033"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXD0"
FT                   /protein_id="ABW10033.1"
FT                   /translation="MRQPARFCRWRPSAAGGGSPAVGAGRGGVCTAGRRARPLGLVIGV
FT                   CNQGVVPIVLAHARALLTGTRQGRTAYLDADLREPEKILASPELAETLDLDRPLVLSLI
FT                   AVLHFIPESDDPYGLVRRYTEVLPSGSYVALTHATGDFAPEEAERVSAVYQARGIALTP
FT                   RSRGGVEGFLTGLDLVEPGVVPVHRWHAEMDAGEELADSRVNVYGAIARVP"
     MRQPARFCRW RPSAAGGGSP AVGAGRGGVC TAGRRARPLG LVIGVCNQGV VPIVLAHARA        60
     LLTGTRQGRT AYLDADLREP EKILASPELA ETLDLDRPLV LSLIAVLHFI PESDDPYGLV       120
     RRYTEVLPSG SYVALTHATG DFAPEEAERV SAVYQARGIA LTPRSRGGVE GFLTGLDLVE       180
     PGVVPVHRWH AEMDAGEELA DSRVNVYGAI ARVP                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page