(data stored in ACNUC7421 zone)

EMBL: CP000820.PE568

CP000820.PE568       Location/Qualifiers
FT   CDS             complement(670881..671684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0578"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; Tetracyclin repressor
FT                   domain protein; KEGG: psb:Psyr_2378 regulatory protein,
FT                   TetR:Tetracyclin repressor, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10037"
FT                   /db_xref="GOA:A8KXD4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR003012"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXD4"
FT                   /protein_id="ABW10037.1"
FT                   /translation="MTSSPPAVTDSLRSPAHDDGAAPTEETAVPAEPGSARWWAERALV
FT                   DRRRRPRAGGLSTERIVETALEILREEGLEALTVRSVAERLGTSNASLYRHIASRDELI
FT                   ALIADHVMGDIRLDRTGRGWRADVEALMFEMRRVILSQPLPPSAGRSKSGSGSGPNMLR
FT                   LVEFALALYREAGLTDRQAVYTTITMIEFVGGSTNIRRSPAGRGSNGVAGAADLRQLLD
FT                   GLPADDFPALRTAGNLYTAASADDVFTHGMTLFLDGVASQLPSSQ"
     MTSSPPAVTD SLRSPAHDDG AAPTEETAVP AEPGSARWWA ERALVDRRRR PRAGGLSTER        60
     IVETALEILR EEGLEALTVR SVAERLGTSN ASLYRHIASR DELIALIADH VMGDIRLDRT       120
     GRGWRADVEA LMFEMRRVIL SQPLPPSAGR SKSGSGSGPN MLRLVEFALA LYREAGLTDR       180
     QAVYTTITMI EFVGGSTNIR RSPAGRGSNG VAGAADLRQL LDGLPADDFP ALRTAGNLYT       240
     AASADDVFTH GMTLFLDGVA SQLPSSQ                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page