(data stored in ACNUC7421 zone)

EMBL: CP000820.PE569

CP000820.PE569       Location/Qualifiers
FT   CDS             671804..672259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10038"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXD5"
FT                   /protein_id="ABW10038.1"
FT                   /translation="MCLPTWVPTAGHESGGVPRRRRRRTLAGRMTRPTPATTHPADRQT
FT                   SCLLPTRAIWPAPSAFSGHHRKGFSARPAEQAGDLRLDLRQPAGKIPRPTSSVDFAGAP
FT                   AGRAPHRRPRRAHQRAGNPPRRKGDPPIPAYTMWPVTVTGDEAGECS"
     MCLPTWVPTA GHESGGVPRR RRRRTLAGRM TRPTPATTHP ADRQTSCLLP TRAIWPAPSA        60
     FSGHHRKGFS ARPAEQAGDL RLDLRQPAGK IPRPTSSVDF AGAPAGRAPH RRPRRAHQRA       120
     GNPPRRKGDP PIPAYTMWPV TVTGDEAGEC S                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page