(data stored in ACNUC7421 zone)

EMBL: CP000820.PE57

CP000820.PE57        Location/Qualifiers
FT   CDS             complement(72866..74167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0058"
FT                   /product="Protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="PFAM: protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase; KEGG: fal:FRAAL6346 putative protein;
FT                   putative O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09526"
FT                   /db_xref="GOA:A8LB65"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR027573"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB65"
FT                   /protein_id="ABW09526.1"
FT                   /translation="MFRLWRRETGARPPEGSSLIQMIGTSSAPDRATEVRNALVDKLCV
FT                   TGMITSLEVERAFRAVPRHLFVPEGTSLEVAYNADDSVAVKRAADGVIISSISAPFIQA
FT                   RMIEQAGLGPGMSVVEIGSSGYNAALLAEIVGPSGRVVSVDIDPEVTDRARALLEATGY
FT                   ADRVTVVRADAQDGVADHGDRVDAILVTAGAWDLSPAWLAQLAEDGRIVVPLRMNGITR
FT                   SIGFRRDGDHLVSTSAEVCGFVPMQGAGAHDERVFLLPDGHGRHVRLRFDANPPQDLDL
FT                   LDGVLATPRSEVWSGVTIRNGVSFADLHLWFACFLSGFCRLAADEGTDLAAERKSWFPF
FT                   GAVQGDSFAYLAVRPALDGAGVEFGGRAYGPHGEAAATALVEQIQAWDRQARGGPAPTF
FT                   AYWPTGADRPPAGEGTAVLAKTHGLVSISWPVAG"
     MFRLWRRETG ARPPEGSSLI QMIGTSSAPD RATEVRNALV DKLCVTGMIT SLEVERAFRA        60
     VPRHLFVPEG TSLEVAYNAD DSVAVKRAAD GVIISSISAP FIQARMIEQA GLGPGMSVVE       120
     IGSSGYNAAL LAEIVGPSGR VVSVDIDPEV TDRARALLEA TGYADRVTVV RADAQDGVAD       180
     HGDRVDAILV TAGAWDLSPA WLAQLAEDGR IVVPLRMNGI TRSIGFRRDG DHLVSTSAEV       240
     CGFVPMQGAG AHDERVFLLP DGHGRHVRLR FDANPPQDLD LLDGVLATPR SEVWSGVTIR       300
     NGVSFADLHL WFACFLSGFC RLAADEGTDL AAERKSWFPF GAVQGDSFAY LAVRPALDGA       360
     GVEFGGRAYG PHGEAAATAL VEQIQAWDRQ ARGGPAPTFA YWPTGADRPP AGEGTAVLAK       420
     THGLVSISWP VAG                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page