(data stored in ACNUC7421 zone)

EMBL: CP000820.PE571

CP000820.PE571       Location/Qualifiers
FT   CDS             673508..674332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0581"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mav:MAV_1264 oxidoreductase, short chain
FT                   dehydrogenase/reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10040"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXD7"
FT                   /protein_id="ABW10040.1"
FT                   /translation="MTLFDAFRFDGKRVLVVGGATGMGAAAAELAQAAGAEVIVADYAE
FT                   VTLPGAKSIHVNLADAASIDTAVDQLGGPVHALLSAAGVADGTPGIERINFIGHRYLID
FT                   RLLAGGLLPRGSAIGFISSAAGLGWEANLPLLKEYLAITDFDEATKWAVEHGKADYMWS
FT                   KQAVCAYVATQAMPLLKQGIRINAICPGPTDTPLARANEERWLGFGTDYRAELGIEAAT
FT                   PLEQAYPLLFLCSDAASAINGITIVTDSGYFTAGISDSFPPATPIVKFMLGR"
     MTLFDAFRFD GKRVLVVGGA TGMGAAAAEL AQAAGAEVIV ADYAEVTLPG AKSIHVNLAD        60
     AASIDTAVDQ LGGPVHALLS AAGVADGTPG IERINFIGHR YLIDRLLAGG LLPRGSAIGF       120
     ISSAAGLGWE ANLPLLKEYL AITDFDEATK WAVEHGKADY MWSKQAVCAY VATQAMPLLK       180
     QGIRINAICP GPTDTPLARA NEERWLGFGT DYRAELGIEA ATPLEQAYPL LFLCSDAASA       240
     INGITIVTDS GYFTAGISDS FPPATPIVKF MLGR                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page