(data stored in ACNUC7421 zone)

EMBL: CP000820.PE576

CP000820.PE576       Location/Qualifiers
FT   CDS             678635..679573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0586"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   rxy:Rxyl_1589 alcohol dehydrogenase GroES-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10045"
FT                   /db_xref="GOA:A8KXE2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXE2"
FT                   /protein_id="ABW10045.1"
FT                   /translation="MKAARPKAGEITVVDLDEPPGVGDEVIRIAAASICSSDLMYMRFG
FT                   LERVIGHELAGVRADGTGAVVEALYGCMECDLCLDGRYNLCPTHIHRALGSSADGGMAE
FT                   QFRVPSQRLVALPPGLDIRDASLVEPASVSWHALRLAGTGPDTRLAVVGAGALGLLAAA
FT                   GARRQGAPEVDLEARHPHQVEAGERLGAKVGTTGLYDVVVEAAGTSASLARAVDLVAPG
FT                   GTVVVVGFHMGTVEVNWSPLFHREARLIPSMSYCRHANGREMEDAAAMLADNPEIARTL
FT                   ITHRFPLEDAVEAFRVAADRKAGALRVVVEP"
     MKAARPKAGE ITVVDLDEPP GVGDEVIRIA AASICSSDLM YMRFGLERVI GHELAGVRAD        60
     GTGAVVEALY GCMECDLCLD GRYNLCPTHI HRALGSSADG GMAEQFRVPS QRLVALPPGL       120
     DIRDASLVEP ASVSWHALRL AGTGPDTRLA VVGAGALGLL AAAGARRQGA PEVDLEARHP       180
     HQVEAGERLG AKVGTTGLYD VVVEAAGTSA SLARAVDLVA PGGTVVVVGF HMGTVEVNWS       240
     PLFHREARLI PSMSYCRHAN GREMEDAAAM LADNPEIART LITHRFPLED AVEAFRVAAD       300
     RKAGALRVVV EP                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page