(data stored in ACNUC7421 zone)

EMBL: CP000820.PE580

CP000820.PE580       Location/Qualifiers
FT   CDS             complement(683536..683943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10049"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYF3"
FT                   /protein_id="ABW10049.1"
FT                   /translation="MVSLRMLPRNLVAAALAIVMMVAVIGFGQGTAHAATCSDRQLPVS
FT                   SAASYLGVDRRHSAQFRGVLSGGVTYVNFWFDGVYRGLYNANGVLVTGSAPISALYKTV
FT                   TTTEIWLGRVRQVVKNVPYLRVCGNYWIKLS"
     MVSLRMLPRN LVAAALAIVM MVAVIGFGQG TAHAATCSDR QLPVSSAASY LGVDRRHSAQ        60
     FRGVLSGGVT YVNFWFDGVY RGLYNANGVL VTGSAPISAL YKTVTTTEIW LGRVRQVVKN       120
     VPYLRVCGNY WIKLS                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page