(data stored in ACNUC7421 zone)

EMBL: CP000820.PE586

CP000820.PE586       Location/Qualifiers
FT   CDS             complement(689068..689679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0596"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mav:MAV_0966
FT                   transcriptional regulator, TetR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10055"
FT                   /db_xref="GOA:A8KYF9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYF9"
FT                   /protein_id="ABW10055.1"
FT                   /translation="MVSQRQAGSATSSTRDQLLDAAEQLMLEEGYAAVTSRRVGARAGL
FT                   TPQLVHYYFRTMDDLFLEVFRRRADVGLELFRAALQSRPTLRQLWDLRDTGMTTPRFNL
FT                   EFMALANHRKAIRVVLTEYYRSYREVQLAAFTAALADLGVPPERCPPLVARLVMIGITQ
FT                   IMAIDAELGVESDSEVVDDFIRRQIEDLVEQGPERTDSDT"
     MVSQRQAGSA TSSTRDQLLD AAEQLMLEEG YAAVTSRRVG ARAGLTPQLV HYYFRTMDDL        60
     FLEVFRRRAD VGLELFRAAL QSRPTLRQLW DLRDTGMTTP RFNLEFMALA NHRKAIRVVL       120
     TEYYRSYREV QLAAFTAALA DLGVPPERCP PLVARLVMIG ITQIMAIDAE LGVESDSEVV       180
     DDFIRRQIED LVEQGPERTD SDT                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page