(data stored in ACNUC7421 zone)

EMBL: CP000820.PE588

CP000820.PE588       Location/Qualifiers
FT   CDS             complement(691509..692768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0598"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: sen:SACE_0229
FT                   cytochrome P450-like enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10057"
FT                   /db_xref="GOA:A8KYG1"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYG1"
FT                   /protein_id="ABW10057.1"
FT                   /translation="MSQLTTRPNAVRRSLPDLLRWLDELRRRGQVHRDDRQRCWHVLGH
FT                   PEAGAVLADHRSFTSDLRGLLPRPEDMPEYNLQEGSFQEDMELFQRGNFVRLDPPEHHR
FT                   LRGLASRAFTSRTVAGLAPRIAEVTTELLDATGGRTRLELIDDLAYPLPVIVIAELLGL
FT                   PAADRPMFRGWADALFDREVADPDQPLTELAAANTRAAVPVLREMNAYLLDRIRACRAH
FT                   PGDDLTGRLVQVEVDGQRLADEEIVGFVGLLLLAGHITTTATLGNAALALDEHPGAAAE
FT                   LRAEPELLPATIEEVLRLRTPFPRLVRRAVADTRVGDEVIPAGAVVTVWLTAANRDERV
FT                   FAEPDRFDPRRAPNPHIAFGQGIHFCLGAPLARLEARTALGILLDRYSDIAVAADVPVE
FT                   HRDPWAMVSVNSLPLDVRPR"
     MSQLTTRPNA VRRSLPDLLR WLDELRRRGQ VHRDDRQRCW HVLGHPEAGA VLADHRSFTS        60
     DLRGLLPRPE DMPEYNLQEG SFQEDMELFQ RGNFVRLDPP EHHRLRGLAS RAFTSRTVAG       120
     LAPRIAEVTT ELLDATGGRT RLELIDDLAY PLPVIVIAEL LGLPAADRPM FRGWADALFD       180
     REVADPDQPL TELAAANTRA AVPVLREMNA YLLDRIRACR AHPGDDLTGR LVQVEVDGQR       240
     LADEEIVGFV GLLLLAGHIT TTATLGNAAL ALDEHPGAAA ELRAEPELLP ATIEEVLRLR       300
     TPFPRLVRRA VADTRVGDEV IPAGAVVTVW LTAANRDERV FAEPDRFDPR RAPNPHIAFG       360
     QGIHFCLGAP LARLEARTAL GILLDRYSDI AVAADVPVEH RDPWAMVSVN SLPLDVRPR        419
//

If you have problems or comments...

PBIL Back to PBIL home page