(data stored in ACNUC7421 zone)

EMBL: CP000820.PE589

CP000820.PE589       Location/Qualifiers
FT   CDS             complement(692912..695728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0599"
FT                   /product="osmosensitive K+ channel signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; Osmosensitive K channel
FT                   His kinase sensor; UspA domain protein; KEGG: fal:FRAAL5304
FT                   sensory histidine kinase in two-component regulatory system
FT                   wtih KdpE, regulation of potassium translocation"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10058"
FT                   /db_xref="GOA:A8KYG2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYG2"
FT                   /protein_id="ABW10058.1"
FT                   /translation="MRNAGRGRAGAFRRPPRRPHHGWVPRGTLRIYLGAAPGVGKTYAA
FT                   LDEAHRRSERGTDVVIGFVETHGRPRTAAMLHDLEIVPRRTLTYRGGSFTEMDLDAVLA
FT                   RRPKVAFVDELAHTNVPGSRHAKRWHDVQELLAAGIDVISTVNVQHLESLNDVVGTITG
FT                   VPQRETVPDDVVRRADQVELVDMAPEALRRRMAHGNVYGPEKVDAALANYFRVGNLTAL
FT                   RELALLWLAGKVDDQLDRYRADHGIGGTWETRERVVVALTGGPEGDTLIRRACRIAARG
FT                   KGADLLAVHVARSDGLTGADPSALARQRALVESLGGSYHQVIGDDVPTALLEFARAENA
FT                   TQLVLGASRRGRLARILSPGIGATTTTRSGSIDVHMVTHPEAWGHRPAPAGGVDAAAHR
FT                   PARPGWPGWRLPRGRTALEPRRRIIAAGLTLVLVPALTAGLAASRGTFNLTTEMLAYLL
FT                   IVVTVALVGGFGPALLCAIASSLLLNYYFTAPVRAWTIADGDNALALLGFVLVASLVSR
FT                   VVSTSARRYEQAVRASAEAATLSVLAGSVLRGEDALPALLARARETFGMTSVTLLERTD
FT                   DDQVGVEWSPVATIAGTGPDGASVDGASGAGPGTSQAGAGGPTGGRADPDGDGDGSEIV
FT                   DIPVREDLRLVLTGRSLPAADRRILTAFAAQAAVALDQHRLREAAAEAAPIAAADKVRT
FT                   ALLTAVSHDLRTPLAAAKAAVSCLRGYDITLTDDEEAELLATADESLDKLTRLVENLLD
FT                   MSRLQAGALSVFPRAVGLDDIVPPALDEIGPAANRIGVRVPDDLPDVRADPVLLERVIV
FT                   NLVTNALRYAPADTPPVITASALGDRVELRVVDSGPGIPVRQRDNVFQPFQRLGDRDNT
FT                   TGVGLGLALSRGLAEAMGGALTPDETPGGGLTMVLSLPAALNPTAVTNPITAPLDVPTG
FT                   PAADDRAG"
     MRNAGRGRAG AFRRPPRRPH HGWVPRGTLR IYLGAAPGVG KTYAALDEAH RRSERGTDVV        60
     IGFVETHGRP RTAAMLHDLE IVPRRTLTYR GGSFTEMDLD AVLARRPKVA FVDELAHTNV       120
     PGSRHAKRWH DVQELLAAGI DVISTVNVQH LESLNDVVGT ITGVPQRETV PDDVVRRADQ       180
     VELVDMAPEA LRRRMAHGNV YGPEKVDAAL ANYFRVGNLT ALRELALLWL AGKVDDQLDR       240
     YRADHGIGGT WETRERVVVA LTGGPEGDTL IRRACRIAAR GKGADLLAVH VARSDGLTGA       300
     DPSALARQRA LVESLGGSYH QVIGDDVPTA LLEFARAENA TQLVLGASRR GRLARILSPG       360
     IGATTTTRSG SIDVHMVTHP EAWGHRPAPA GGVDAAAHRP ARPGWPGWRL PRGRTALEPR       420
     RRIIAAGLTL VLVPALTAGL AASRGTFNLT TEMLAYLLIV VTVALVGGFG PALLCAIASS       480
     LLLNYYFTAP VRAWTIADGD NALALLGFVL VASLVSRVVS TSARRYEQAV RASAEAATLS       540
     VLAGSVLRGE DALPALLARA RETFGMTSVT LLERTDDDQV GVEWSPVATI AGTGPDGASV       600
     DGASGAGPGT SQAGAGGPTG GRADPDGDGD GSEIVDIPVR EDLRLVLTGR SLPAADRRIL       660
     TAFAAQAAVA LDQHRLREAA AEAAPIAAAD KVRTALLTAV SHDLRTPLAA AKAAVSCLRG       720
     YDITLTDDEE AELLATADES LDKLTRLVEN LLDMSRLQAG ALSVFPRAVG LDDIVPPALD       780
     EIGPAANRIG VRVPDDLPDV RADPVLLERV IVNLVTNALR YAPADTPPVI TASALGDRVE       840
     LRVVDSGPGI PVRQRDNVFQ PFQRLGDRDN TTGVGLGLAL SRGLAEAMGG ALTPDETPGG       900
     GLTMVLSLPA ALNPTAVTNP ITAPLDVPTG PAADDRAG                               938
//

If you have problems or comments...

PBIL Back to PBIL home page