(data stored in ACNUC7421 zone)

EMBL: CP000820.PE591

CP000820.PE591       Location/Qualifiers
FT   CDS             697782..700046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0601"
FT                   /product="K+-transporting ATPase, B subunit"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; K+-transporting ATPase, B
FT                   subunit; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; E1-E2 ATPase-associated domain protein; KEGG:
FT                   fal:FRAAL5301 P-type ATPase, high-affinity potassium
FT                   transport system, B chain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10060"
FT                   /db_xref="GOA:A8KYG4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYG4"
FT                   /protein_id="ABW10060.1"
FT                   /translation="MSTTTIAAHQDGASAAGRRETQPARPRRVGGGLLDPKQLWTSLPS
FT                   AVRKLDPRTLWHNPVMLIVEVGAAYTTVLAIIDPSAFGWMITVWLWLTVIFANLAEAVA
FT                   EGRGKAQAAALRRARTETVARRLVGWRAGQPVESAAVESVPAPRLAQHDLVVVEAGELI
FT                   PGDGDIVEGIASVDESAITGESAPVIRESGGDRSSVTGGTRVLSDRIVVRITQKPGESF
FT                   IDRMIALVEGANRRKTPNEIALNILLAALTVIFLLAVATLQPLAIYSKAQQPALPDSST
FT                   LTGDGITGIVLASLLVCLIPTTIGALLSAIGIAGMDRLVQRNVLAMSGRAVEAAGDVNT
FT                   LLLDKTGTITLGNRQASAFLAVGGVSEAELADAAQLSSLADETPEGRSVVVFAKEHHGL
FT                   RERTPGELAHATFVHFTAQTRMSGVDLAPEPTGPGAPGAPGTSSAVGARRVRKGAASAV
FT                   TRWVRENGGQVPAQVGEIVDGISASGGTPLVVGEVIDGPSGPSGPSGPAARVLGVIQLK
FT                   DVVKSGMRERFDAMRRMGIRTVMITGDNPLTAKAIADEAGVDDFLAEATPEDKLALIRR
FT                   EQAGGKLVAMTGDGTNDAPALAQADVGVAMNTGTSAAKEAGNMVDLDSNPTKLIEIVEI
FT                   GKQLLITRGALTTFSIANDVAKYFAIIPAMFAGVYTGLDRLNVMRLASPESAILSAVIF
FT                   NALVIVALIPLALRGVRYTPASASKLLSRNLYVYGLGGIVVPFAGIKVIDLLVQFIPGV
FT                   G"
     MSTTTIAAHQ DGASAAGRRE TQPARPRRVG GGLLDPKQLW TSLPSAVRKL DPRTLWHNPV        60
     MLIVEVGAAY TTVLAIIDPS AFGWMITVWL WLTVIFANLA EAVAEGRGKA QAAALRRART       120
     ETVARRLVGW RAGQPVESAA VESVPAPRLA QHDLVVVEAG ELIPGDGDIV EGIASVDESA       180
     ITGESAPVIR ESGGDRSSVT GGTRVLSDRI VVRITQKPGE SFIDRMIALV EGANRRKTPN       240
     EIALNILLAA LTVIFLLAVA TLQPLAIYSK AQQPALPDSS TLTGDGITGI VLASLLVCLI       300
     PTTIGALLSA IGIAGMDRLV QRNVLAMSGR AVEAAGDVNT LLLDKTGTIT LGNRQASAFL       360
     AVGGVSEAEL ADAAQLSSLA DETPEGRSVV VFAKEHHGLR ERTPGELAHA TFVHFTAQTR       420
     MSGVDLAPEP TGPGAPGAPG TSSAVGARRV RKGAASAVTR WVRENGGQVP AQVGEIVDGI       480
     SASGGTPLVV GEVIDGPSGP SGPSGPAARV LGVIQLKDVV KSGMRERFDA MRRMGIRTVM       540
     ITGDNPLTAK AIADEAGVDD FLAEATPEDK LALIRREQAG GKLVAMTGDG TNDAPALAQA       600
     DVGVAMNTGT SAAKEAGNMV DLDSNPTKLI EIVEIGKQLL ITRGALTTFS IANDVAKYFA       660
     IIPAMFAGVY TGLDRLNVMR LASPESAILS AVIFNALVIV ALIPLALRGV RYTPASASKL       720
     LSRNLYVYGL GGIVVPFAGI KVIDLLVQFI PGVG                                   754
//

If you have problems or comments...

PBIL Back to PBIL home page