(data stored in ACNUC7421 zone)

EMBL: CP000820.PE593

CP000820.PE593       Location/Qualifiers
FT   CDS             701147..701395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10062"
FT                   /db_xref="GOA:A8KYG6"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYG6"
FT                   /protein_id="ABW10062.1"
FT                   /translation="MRPVAAAQGQADATHEGPNTTDLSTQTKPRSAQARARTSPGQARA
FT                   ELVVVGFGALMVSMSQSLLVPVLPTLPAELNASASEV"
     MRPVAAAQGQ ADATHEGPNT TDLSTQTKPR SAQARARTSP GQARAELVVV GFGALMVSMS        60
     QSLLVPVLPT LPAELNASAS EV                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page