(data stored in ACNUC7421 zone)

EMBL: CP000820.PE598

CP000820.PE598       Location/Qualifiers
FT   CDS             706383..707201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0608"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: fal:FRAAL2875
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10067"
FT                   /db_xref="GOA:A8KYH1"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYH1"
FT                   /protein_id="ABW10067.1"
FT                   /translation="MPMGARRPWCVRHDVVMTVETVRLRLGRGGNGVGNEDRGCADAPG
FT                   GTVPVSVAAPASAVSPRGGVIVIPDARGITNYVLAVCEQLCAEGWLALTPHLYHRDGLT
FT                   EVPVAEGSSKMLTLTAAGIAADVDACLEHLATVGLPPSRAAIIGFCMGGTAAFLTSVRH
FT                   RLGAAVSFYGGAVSTPYWTGAPPLLDVADQLRTPWLGLYGENDTWVTLDEIRSLRAAAA
FT                   RAPVPTELISYPGAQHAFHTPERPSTHDPVAARDAWARMLRWLEIHVATT"
     MPMGARRPWC VRHDVVMTVE TVRLRLGRGG NGVGNEDRGC ADAPGGTVPV SVAAPASAVS        60
     PRGGVIVIPD ARGITNYVLA VCEQLCAEGW LALTPHLYHR DGLTEVPVAE GSSKMLTLTA       120
     AGIAADVDAC LEHLATVGLP PSRAAIIGFC MGGTAAFLTS VRHRLGAAVS FYGGAVSTPY       180
     WTGAPPLLDV ADQLRTPWLG LYGENDTWVT LDEIRSLRAA AARAPVPTEL ISYPGAQHAF       240
     HTPERPSTHD PVAARDAWAR MLRWLEIHVA TT                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page