(data stored in ACNUC7421 zone)

EMBL: CP000820.PE600

CP000820.PE600       Location/Qualifiers
FT   CDS             708972..709787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0610"
FT                   /product="Survival protein SurE"
FT                   /note="PFAM: Survival protein SurE; KEGG: mem:Memar_1385
FT                   stationary-phase survival protein SurE"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10069"
FT                   /db_xref="GOA:A8KYH3"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYH3"
FT                   /protein_id="ABW10069.1"
FT                   /translation="MKRRVQSTGGRSGDSGRRRGDLVGQVGRSDRRRRTARASAALLAA
FT                   VAVVLTAAGCGGGGKTTMPTPTHRDAATAGGITATAVDGFPADAVTVALDVLRLTPDLV
FT                   VSGINQGQNLGPVVDLSGTVGAARAAASRGVPAIASSMGTGDAFDFAPAVKLVTDWVTA
FT                   HRAELSAGAPSSGPRATIANLNIPNCAAGGRIRGERELPTQPALPDLAVALAPQDCTSS
FT                   AEPGEEVAAFTAGFATLTEIPASPASPASPDTPAAVVTAAPAGPSPAAK"
     MKRRVQSTGG RSGDSGRRRG DLVGQVGRSD RRRRTARASA ALLAAVAVVL TAAGCGGGGK        60
     TTMPTPTHRD AATAGGITAT AVDGFPADAV TVALDVLRLT PDLVVSGINQ GQNLGPVVDL       120
     SGTVGAARAA ASRGVPAIAS SMGTGDAFDF APAVKLVTDW VTAHRAELSA GAPSSGPRAT       180
     IANLNIPNCA AGGRIRGERE LPTQPALPDL AVALAPQDCT SSAEPGEEVA AFTAGFATLT       240
     EIPASPASPA SPDTPAAVVT AAPAGPSPAA K                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page