(data stored in ACNUC7421 zone)

EMBL: CP000820.PE601

CP000820.PE601       Location/Qualifiers
FT   CDS             709944..711356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0611"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10070"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYH4"
FT                   /protein_id="ABW10070.1"
FT                   /translation="MSGTGGKTAARRATRVSAVVGSAVMGIALAVPFAVAVGPAASAAS
FT                   AAAPVVSAGGDAARGAGSTVPTVLSTATLPDIPLADFSNGLIRGSVDTDRGVDLGGIGS
FT                   DLFPAGRPNEFWTITDRGPNGQIKIDGKNRRTFPVPGFDPAIVRVRADGSTIKVLDALP
FT                   ITTAHGKPVTGLSNINGFDETPYTWDAQTPLPFDPNGLDTEGLIRTRSGEFWLVDEYSP
FT                   SLLRVSARGQVLARYIPAGVNLTGADYPVVASLPGVLGGRKINRGFEGIALAPDGRTLY
FT                   LAVQSPLQLPDAGTGNASRNVRIFRFDTASSKVTGEYVYRFEDVATFDPDADGDPSEMK
FT                   ISSLAAVDGNTLLVNERTDAVSRLYSVDLRQATNILGSRWDHTATAPSLESLADPAKAG
FT                   VTVLPKRLAVDLEGVAGMPDKIEGIAIVDRRTIAVANDNDFGLGSFNEAGQLVDSGVES
FT                   KILQLRLNRPLG"
     MSGTGGKTAA RRATRVSAVV GSAVMGIALA VPFAVAVGPA ASAASAAAPV VSAGGDAARG        60
     AGSTVPTVLS TATLPDIPLA DFSNGLIRGS VDTDRGVDLG GIGSDLFPAG RPNEFWTITD       120
     RGPNGQIKID GKNRRTFPVP GFDPAIVRVR ADGSTIKVLD ALPITTAHGK PVTGLSNING       180
     FDETPYTWDA QTPLPFDPNG LDTEGLIRTR SGEFWLVDEY SPSLLRVSAR GQVLARYIPA       240
     GVNLTGADYP VVASLPGVLG GRKINRGFEG IALAPDGRTL YLAVQSPLQL PDAGTGNASR       300
     NVRIFRFDTA SSKVTGEYVY RFEDVATFDP DADGDPSEMK ISSLAAVDGN TLLVNERTDA       360
     VSRLYSVDLR QATNILGSRW DHTATAPSLE SLADPAKAGV TVLPKRLAVD LEGVAGMPDK       420
     IEGIAIVDRR TIAVANDNDF GLGSFNEAGQ LVDSGVESKI LQLRLNRPLG                  470
//

If you have problems or comments...

PBIL Back to PBIL home page