(data stored in ACNUC7421 zone)

EMBL: CP000820.PE605

CP000820.PE605       Location/Qualifiers
FT   CDS             715666..716901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0615"
FT                   /product="Formyl-CoA transferase"
FT                   /EC_number="2.8.3.16"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: fal:FRAAL3537 putative fatty acid-CoA
FT                   racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10074"
FT                   /db_xref="GOA:A8KYH8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYH8"
FT                   /protein_id="ABW10074.1"
FT                   /translation="MGWPMEDSASEGAFKGVRVVELAQWVFVPVAGALLADWGADVIRV
FT                   ERPEGDPYRALATQGIGTDGGGVNLSVALANRGKRSVALDLRGEQGKAILHKMLETADV
FT                   FLTNFRPGALRRLGLDADELTRRYPRLVYARGHGFGARGPDADHPGYDSSAFWARGGMG
FT                   YTLTPEEREYPISQRGAMGDRNGAMALAFGIAAALLGRTRTGRGTVVDVSLLATAMWTL
FT                   SSDLLVALTGQAPRISSGPGDGPNPLVGAYRTKDGRHIQLVFLESDRYWAPFCELIGRG
FT                   DLVADPRFADLRARGENRVACRAELEAAFATRTFEEWKDLLAGIDAPWAPVQSVLELVD
FT                   DPQVVANGYVGEVQLDGGGSYRLPTVPVQFDSQPPVPRRAPEHGEHTESVLLELGYTWE
FT                   EIAALTEAGAIP"
     MGWPMEDSAS EGAFKGVRVV ELAQWVFVPV AGALLADWGA DVIRVERPEG DPYRALATQG        60
     IGTDGGGVNL SVALANRGKR SVALDLRGEQ GKAILHKMLE TADVFLTNFR PGALRRLGLD       120
     ADELTRRYPR LVYARGHGFG ARGPDADHPG YDSSAFWARG GMGYTLTPEE REYPISQRGA       180
     MGDRNGAMAL AFGIAAALLG RTRTGRGTVV DVSLLATAMW TLSSDLLVAL TGQAPRISSG       240
     PGDGPNPLVG AYRTKDGRHI QLVFLESDRY WAPFCELIGR GDLVADPRFA DLRARGENRV       300
     ACRAELEAAF ATRTFEEWKD LLAGIDAPWA PVQSVLELVD DPQVVANGYV GEVQLDGGGS       360
     YRLPTVPVQF DSQPPVPRRA PEHGEHTESV LLELGYTWEE IAALTEAGAI P                411
//

If you have problems or comments...

PBIL Back to PBIL home page