(data stored in ACNUC7421 zone)

EMBL: CP000820.PE606

CP000820.PE606       Location/Qualifiers
FT   CDS             716898..717428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0616"
FT                   /product="protein of unknown function DUF35"
FT                   /note="PFAM: protein of unknown function DUF35; KEGG:
FT                   fal:FRAAL0408 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10075"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYH9"
FT                   /protein_id="ABW10075.1"
FT                   /translation="MTAGPAAASAPAGPAGASGSAGPAAAPEPTRPVPAPDERSAPYWA
FT                   AAARHVLTVARCARCSTYVVPPDHTCPHCGSTDPGFAFEPVSGRGTVRSWTVVRQSFLP
FT                   GFRGEVPFLLVDVELAEQPELRIIGRLLDGPDTTLRIGAPVAVAFEDVADGVSVPAFAL
FT                   AESSATGPGEVRS"
     MTAGPAAASA PAGPAGASGS AGPAAAPEPT RPVPAPDERS APYWAAAARH VLTVARCARC        60
     STYVVPPDHT CPHCGSTDPG FAFEPVSGRG TVRSWTVVRQ SFLPGFRGEV PFLLVDVELA       120
     EQPELRIIGR LLDGPDTTLR IGAPVAVAFE DVADGVSVPA FALAESSATG PGEVRS           176
//

If you have problems or comments...

PBIL Back to PBIL home page