(data stored in ACNUC7421 zone)

EMBL: CP000820.PE608

CP000820.PE608       Location/Qualifiers
FT   CDS             718750..720219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0618"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mpa:MAP2187c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10077"
FT                   /db_xref="GOA:A8KYI1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYI1"
FT                   /protein_id="ABW10077.1"
FT                   /translation="MAAIIAERRSYVAGTWVEGDEVFAVENPADETSVADVAATPLPEI
FT                   ERAITEARRSFDEGVWADRSPAERARVLGAFLDYFQSARAELVATMVAEAGQPTGFAER
FT                   AQFGAGLGLARGTIDLYLSMSHEEANPVPLDDLVRAGASLSFRRHEPVGVVTAITPYNG
FT                   AIIMAMQKIIPALIAGNSVILRPSPLTPLSSLVFGAAAEAAGLPPGVLSVVVEGGAAGA
FT                   ELLTTHRAVDMVSFTGSTVVGRQILAQAAPTVKRVALELGGKSAQIYLPDAVGRATAGA
FT                   VAVVAATAGQACVAATRMLVPRERKDEVLDAVSRAYGALTVGPPTDPSAKLGPVISAGQ
FT                   RDRCERFVRLAEENGGKVVTGGGRPAGLERGYYFEPTVLDLPDNANPAAQEEIFGPVIS
FT                   VLGYRDLDDAVRIANDSDYGLSGQVYGADVAAAVGVARRLRTGAVNVNTAVFSAYAPGG
FT                   GYKHSGLGRERGPDGIRAFQEVKHLAIGELR"
     MAAIIAERRS YVAGTWVEGD EVFAVENPAD ETSVADVAAT PLPEIERAIT EARRSFDEGV        60
     WADRSPAERA RVLGAFLDYF QSARAELVAT MVAEAGQPTG FAERAQFGAG LGLARGTIDL       120
     YLSMSHEEAN PVPLDDLVRA GASLSFRRHE PVGVVTAITP YNGAIIMAMQ KIIPALIAGN       180
     SVILRPSPLT PLSSLVFGAA AEAAGLPPGV LSVVVEGGAA GAELLTTHRA VDMVSFTGST       240
     VVGRQILAQA APTVKRVALE LGGKSAQIYL PDAVGRATAG AVAVVAATAG QACVAATRML       300
     VPRERKDEVL DAVSRAYGAL TVGPPTDPSA KLGPVISAGQ RDRCERFVRL AEENGGKVVT       360
     GGGRPAGLER GYYFEPTVLD LPDNANPAAQ EEIFGPVISV LGYRDLDDAV RIANDSDYGL       420
     SGQVYGADVA AAVGVARRLR TGAVNVNTAV FSAYAPGGGY KHSGLGRERG PDGIRAFQEV       480
     KHLAIGELR                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page