(data stored in ACNUC7421 zone)

EMBL: CP000820.PE61

CP000820.PE61        Location/Qualifiers
FT   CDS             77817..79001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0062"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: helix-turn-helix domain protein; protein of
FT                   unknown function DUF955; KEGG: sco:SCO3537 DNA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09530"
FT                   /db_xref="GOA:A8LB69"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB69"
FT                   /protein_id="ABW09530.1"
FT                   /translation="MDDPRQLRLLSLPAPASGSVASLAVIAAEFDPARLAQARRLAGLT
FT                   KRAVAGQLGVSPVAVGQWEAGTHAPRPDHVGRLAEVLDVPPAFLAAGRPYARLESSAAH
FT                   FRSLRRTPVSQRNKAIAFTEQVWELTYALEKRVQLPPVDLPGFSAGEVVTDVAGTDPAG
FT                   AARALRQAWNLGTGPIPHLVRTMENHGLIVTLVPFAGTATATVDAFSTSHLPRPVVVLT
FT                   PDRANDVYRHRFTAAHELGHLLLHPDTAPGDAIQEKEADAFAAELLTPSAEITPQLPAR
FT                   VDLHALDQLSKQWGVSVDSLVYRCREVGAVSDAAYRRAYQRLNQLRQLGLFAREPVDGY
FT                   RGEVPILLNRAYALAEEHGLTLATLARELACTLPRLRLLLGHADTDTRPQLRLV"
     MDDPRQLRLL SLPAPASGSV ASLAVIAAEF DPARLAQARR LAGLTKRAVA GQLGVSPVAV        60
     GQWEAGTHAP RPDHVGRLAE VLDVPPAFLA AGRPYARLES SAAHFRSLRR TPVSQRNKAI       120
     AFTEQVWELT YALEKRVQLP PVDLPGFSAG EVVTDVAGTD PAGAARALRQ AWNLGTGPIP       180
     HLVRTMENHG LIVTLVPFAG TATATVDAFS TSHLPRPVVV LTPDRANDVY RHRFTAAHEL       240
     GHLLLHPDTA PGDAIQEKEA DAFAAELLTP SAEITPQLPA RVDLHALDQL SKQWGVSVDS       300
     LVYRCREVGA VSDAAYRRAY QRLNQLRQLG LFAREPVDGY RGEVPILLNR AYALAEEHGL       360
     TLATLARELA CTLPRLRLLL GHADTDTRPQ LRLV                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page