(data stored in ACNUC7421 zone)

EMBL: CP000820.PE612

CP000820.PE612       Location/Qualifiers
FT   CDS             722500..723747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0622"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mpa:MAP2183c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10081"
FT                   /db_xref="GOA:A8KYI5"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYI5"
FT                   /protein_id="ABW10081.1"
FT                   /translation="MSTTATLDRERVRQLFDLRSSYNVHMGGGYRQDPYPVWHRLREQA
FT                   PVHPGIVHELTGFDGPAMFSGLPYPDRPHFSAFSYAACDAAYRDPEVFASAAGPVDPNN
FT                   GPYGATNSMLSMGGRQHRRYRGLVQPSFVPGKAKWWISNWIEETVDLLIDGFVDAGRAE
FT                   LNVDFCAAIPVLTITSSFGVPVDRALDIRAALTRPDEIVRMLEPIVAARRADPQDDLIS
FT                   ILVQAEMTDENGVTHRLTDAEIYSFSVLLLTAGSGTTWKQMGITLTALLQHPEALAAVR
FT                   ADRSLLRLAIEESLRWSPTDPMFSRWVTEDVDFFGVHMPAGSVLHLCIGAANRDPARWD
FT                   RPDEYDITRALRPSFAFGGGAHVCLGMHVARAEMRVGIGALLDRLPDLRLDPDREAPRF
FT                   IGMYERGATEIPVVFG"
     MSTTATLDRE RVRQLFDLRS SYNVHMGGGY RQDPYPVWHR LREQAPVHPG IVHELTGFDG        60
     PAMFSGLPYP DRPHFSAFSY AACDAAYRDP EVFASAAGPV DPNNGPYGAT NSMLSMGGRQ       120
     HRRYRGLVQP SFVPGKAKWW ISNWIEETVD LLIDGFVDAG RAELNVDFCA AIPVLTITSS       180
     FGVPVDRALD IRAALTRPDE IVRMLEPIVA ARRADPQDDL ISILVQAEMT DENGVTHRLT       240
     DAEIYSFSVL LLTAGSGTTW KQMGITLTAL LQHPEALAAV RADRSLLRLA IEESLRWSPT       300
     DPMFSRWVTE DVDFFGVHMP AGSVLHLCIG AANRDPARWD RPDEYDITRA LRPSFAFGGG       360
     AHVCLGMHVA RAEMRVGIGA LLDRLPDLRL DPDREAPRFI GMYERGATEI PVVFG            415
//

If you have problems or comments...

PBIL Back to PBIL home page