(data stored in ACNUC7421 zone)

EMBL: CP000820.PE65

CP000820.PE65        Location/Qualifiers
FT   CDS             complement(82991..83287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09534"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB73"
FT                   /protein_id="ABW09534.1"
FT                   /translation="MGRYGIVDLAGIQKEDVDALLAPYWTRDNVVDVSDISSQLRDIRD
FT                   SLAPLIDEDGTPASTSFGLRSVEISLALSLEGKVMFVAKGSVDASIKLSFGRR"
     MGRYGIVDLA GIQKEDVDAL LAPYWTRDNV VDVSDISSQL RDIRDSLAPL IDEDGTPAST        60
     SFGLRSVEIS LALSLEGKVM FVAKGSVDAS IKLSFGRR                                98
//

If you have problems or comments...

PBIL Back to PBIL home page