(data stored in ACNUC7421 zone)

EMBL: CP000820.PE67

CP000820.PE67        Location/Qualifiers
FT   CDS             83908..84387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09536"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB75"
FT                   /protein_id="ABW09536.1"
FT                   /translation="MSRRSTARCLTHSATVSFSAPAVSPDPRLTGGVQREIAGRIATLV
FT                   ADDAAPQLGIGYVNGHAASWSVRQQARDLVEKVAHPRSPRAHRSGWFSAAPAPDIRHAG
FT                   DRGRLAGEVADVGCSAKMRGRGRSAGVAVALTWIRARMEAVGGRTGRGRKPSSVR"
     MSRRSTARCL THSATVSFSA PAVSPDPRLT GGVQREIAGR IATLVADDAA PQLGIGYVNG        60
     HAASWSVRQQ ARDLVEKVAH PRSPRAHRSG WFSAAPAPDI RHAGDRGRLA GEVADVGCSA       120
     KMRGRGRSAG VAVALTWIRA RMEAVGGRTG RGRKPSSVR                              159
//

If you have problems or comments...

PBIL Back to PBIL home page