(data stored in ACNUC7421 zone)

EMBL: CP000820.PE7

CP000820.PE7         Location/Qualifiers
FT   CDS             9711..12224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: fal:FRAAL0009 DNA gyrase, subunit A, type II
FT                   topoisomerase; TIGRFAM: DNA gyrase, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV subunit A; DNA gyrase repeat
FT                   beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09476"
FT                   /db_xref="GOA:A8LB22"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB22"
FT                   /protein_id="ABW09476.1"
FT                   /translation="MVDVLPPPPGDRIEPIGIEVEMQRSYLDYAMSVIVGRALPEVRDG
FT                   LKPVHRRVLYAMYDGGYRPDRGYFKCSRVVGDVMGNYHPHGDSAIYDTLVRLAQPWSLR
FT                   YPLVDGNGNFGSPGNDPPAAMRYTEARMAPLAMEMLRDIDQETVDFAPNYDGRSQEPLV
FT                   LPSRFPNLLVNGAGGIAVGMATNIPPHNLVEVAKGVQWSLDHPEATAEELLEALLGIIK
FT                   GPDFPTHGLIVGRNGIEDAYRTGRGSIRMRAVVNVEENKGRTQLVVTELPYQVNPDNLA
FT                   EKIAELVRDNKVTGISDVRDETSARIGQRLVIDLKRDAVAKVVLNNLYKHTQLQDTFGV
FT                   NMLAIVDGVPRTLRLDQMISYYVEHQVDVIVRRTRYQLRKARERLHVLDGLLIALDHLD
FT                   EVIALIRNAESAEVARGQLMARFSLSEIQATAILDMQLRRLAFLERQRIIDEAAELRAK
FT                   IDELEAILASPVRQREIIGQELAEVVEKFGDERRTRLVPFEGDMSVEDLIAREDVVVTV
FT                   TRGGYAKRTKTDLYRSQKRGGKGVQGAALREDDIVEHFFVTTTHHWLLFFTNKGRVYRA
FT                   KAHELPEQARSAKGQHVANILAFSQDERIAEVMAIQDYQAAPYLVLATKRGLCKKTALT
FT                   DFDSNRAGGLVAINLRDDDELISARLVAPGDDLLLVSRNAQSIRFHADDEQLRPMGRAT
FT                   SGVIGMRFDEADELLSMDVVVPESPADLLVATSGGYAKRTPLAEYPIQGRGGKGVLTAK
FT                   IVSTRGGLVGALVVEPNDQLYAITSNGGVLRTVAKDVRRAQRQTMGVRLIDLEAGVQVV
FT                   GVARNADANDSDGDGETAGSDGTAG"
     MVDVLPPPPG DRIEPIGIEV EMQRSYLDYA MSVIVGRALP EVRDGLKPVH RRVLYAMYDG        60
     GYRPDRGYFK CSRVVGDVMG NYHPHGDSAI YDTLVRLAQP WSLRYPLVDG NGNFGSPGND       120
     PPAAMRYTEA RMAPLAMEML RDIDQETVDF APNYDGRSQE PLVLPSRFPN LLVNGAGGIA       180
     VGMATNIPPH NLVEVAKGVQ WSLDHPEATA EELLEALLGI IKGPDFPTHG LIVGRNGIED       240
     AYRTGRGSIR MRAVVNVEEN KGRTQLVVTE LPYQVNPDNL AEKIAELVRD NKVTGISDVR       300
     DETSARIGQR LVIDLKRDAV AKVVLNNLYK HTQLQDTFGV NMLAIVDGVP RTLRLDQMIS       360
     YYVEHQVDVI VRRTRYQLRK ARERLHVLDG LLIALDHLDE VIALIRNAES AEVARGQLMA       420
     RFSLSEIQAT AILDMQLRRL AFLERQRIID EAAELRAKID ELEAILASPV RQREIIGQEL       480
     AEVVEKFGDE RRTRLVPFEG DMSVEDLIAR EDVVVTVTRG GYAKRTKTDL YRSQKRGGKG       540
     VQGAALREDD IVEHFFVTTT HHWLLFFTNK GRVYRAKAHE LPEQARSAKG QHVANILAFS       600
     QDERIAEVMA IQDYQAAPYL VLATKRGLCK KTALTDFDSN RAGGLVAINL RDDDELISAR       660
     LVAPGDDLLL VSRNAQSIRF HADDEQLRPM GRATSGVIGM RFDEADELLS MDVVVPESPA       720
     DLLVATSGGY AKRTPLAEYP IQGRGGKGVL TAKIVSTRGG LVGALVVEPN DQLYAITSNG       780
     GVLRTVAKDV RRAQRQTMGV RLIDLEAGVQ VVGVARNADA NDSDGDGETA GSDGTAG          837
//

If you have problems or comments...

PBIL Back to PBIL home page