(data stored in ACNUC7421 zone)

EMBL: CP000820.PE76

CP000820.PE76        Location/Qualifiers
FT   CDS             complement(95113..95979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0078"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: tth:TTC1745 corticosteroid 11-beta-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09545"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB84"
FT                   /protein_id="ABW09545.1"
FT                   /translation="MTETERRGGVLVSGAAGGIGAATVRLLADRGYLVFAAVRAENHTS
FT                   RVLADLSGVQVVTMDVADPESVATAAEEVNGAVPNGGLRAVVNNAGVIVQGPLELVPPD
FT                   ELRRQFEVNTFGPAYVTQAFLPMLRAGHGRIINVTAPTARVPMPFMAPISASKAALDAL
FT                   STALRLELAAWKVPVVLVEPGATETQIFDKADTAAREALGAATPAQVALYRDHLTAMEQ
FT                   ARKRLRTRPVEPVARAIATAVTARRPRRRYSIADARAIGVLAHLPARLRERLVMSTLGL
FT                   RGVGTER"
     MTETERRGGV LVSGAAGGIG AATVRLLADR GYLVFAAVRA ENHTSRVLAD LSGVQVVTMD        60
     VADPESVATA AEEVNGAVPN GGLRAVVNNA GVIVQGPLEL VPPDELRRQF EVNTFGPAYV       120
     TQAFLPMLRA GHGRIINVTA PTARVPMPFM APISASKAAL DALSTALRLE LAAWKVPVVL       180
     VEPGATETQI FDKADTAARE ALGAATPAQV ALYRDHLTAM EQARKRLRTR PVEPVARAIA       240
     TAVTARRPRR RYSIADARAI GVLAHLPARL RERLVMSTLG LRGVGTER                    288
//

If you have problems or comments...

PBIL Back to PBIL home page