(data stored in ACNUC7421 zone)

EMBL: CP000820.PE77

CP000820.PE77        Location/Qualifiers
FT   CDS             96103..96657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0079"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: mjl:Mjls_5238 transcriptional regulator, PadR-like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09546"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB85"
FT                   /protein_id="ABW09546.1"
FT                   /translation="MSLRHGLLGLLAEGPASGYDLARRFQEVLGQIWPAQHPKIYAELR
FT                   RLTDDGLIEVDTEGPRRRKAYRITDAGLDEIRDWLTTGEIDHTMRVQSLLRSLFFWLMD
FT                   PDDLRRRLDEEARFFAESAARYRAYADAKDRGEFGDNPQVRSMRVTIEAGVRLYQALAD
FT                   WAEWAKTVSPPSTPRDISTNH"
     MSLRHGLLGL LAEGPASGYD LARRFQEVLG QIWPAQHPKI YAELRRLTDD GLIEVDTEGP        60
     RRRKAYRITD AGLDEIRDWL TTGEIDHTMR VQSLLRSLFF WLMDPDDLRR RLDEEARFFA       120
     ESAARYRAYA DAKDRGEFGD NPQVRSMRVT IEAGVRLYQA LADWAEWAKT VSPPSTPRDI       180
     STNH                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page