(data stored in ACNUC7421 zone)

EMBL: CP000820.PE78

CP000820.PE78        Location/Qualifiers
FT   CDS             complement(97102..97470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0080"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1739 putative integrase (partial)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09547"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB86"
FT                   /protein_id="ABW09547.1"
FT                   /translation="MRGATGPASTAVHGRAQTVARRGPHRDLMQARCMSSDLCNGRTAR
FT                   FESSSRRPGDHAGRCRFPSLALGALHRQRSRQAKERIDAGEHWWENGLVFASTVGTLME
FT                   PRNVTRRVEQLRDRAGLP"
     MRGATGPAST AVHGRAQTVA RRGPHRDLMQ ARCMSSDLCN GRTARFESSS RRPGDHAGRC        60
     RFPSLALGAL HRQRSRQAKE RIDAGEHWWE NGLVFASTVG TLMEPRNVTR RVEQLRDRAG       120
     LP                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page