(data stored in ACNUC7421 zone)

EMBL: CP000820.PE80

CP000820.PE80        Location/Qualifiers
FT   CDS             complement(98997..99656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0082"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: sma:SAV2405 two-component
FT                   system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09549"
FT                   /db_xref="GOA:A8LB88"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB88"
FT                   /protein_id="ABW09549.1"
FT                   /translation="MVRVMVVEDEPELAGALCEALTRESFAVDVAYDGDEALEKCAAHD
FT                   YDVVVLDRDLPVVHGDDVCRAIVATQRSTRVLMLTAASAIRARVEGLAIGADDYLVKPF
FT                   ALAELSARVHALARRTAPAAAPILERAGLRVDQASRTVTRDGRSVILTNKEYAVLVELL
FT                   RAAGGVLSAEQLLEKVWDENIAPFTNTVRMTVMKLRRKLGTPQLIETLPAAGYRIP"
     MVRVMVVEDE PELAGALCEA LTRESFAVDV AYDGDEALEK CAAHDYDVVV LDRDLPVVHG        60
     DDVCRAIVAT QRSTRVLMLT AASAIRARVE GLAIGADDYL VKPFALAELS ARVHALARRT       120
     APAAAPILER AGLRVDQASR TVTRDGRSVI LTNKEYAVLV ELLRAAGGVL SAEQLLEKVW       180
     DENIAPFTNT VRMTVMKLRR KLGTPQLIET LPAAGYRIP                              219
//

If you have problems or comments...

PBIL Back to PBIL home page